GGRNA Home | Help | Advanced search

2025-11-17 12:38:58, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_145652               1018 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens WAP four-disulfide core domain 5 (WFDC5), mRNA.
ACCESSION   NM_145652
VERSION     NM_145652.3  GI:336391118
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1018)
  AUTHORS   Mukhopadhyay,S.S. and Rosen,J.M.
  TITLE     The C-terminal domain of the nuclear factor I-B2 isoform is
            glycosylated and transactivates the WAP gene in the JEG-3 cells
  JOURNAL   Biochem. Biophys. Res. Commun. 358 (3), 770-776 (2007)
   PUBMED   17511965
  REMARK    GeneRIF: C-terminal domain of the nuclear factor I-B2 isoform is
            glycosylated and transactivates the WAP gene in tumor cells
REFERENCE   2  (bases 1 to 1018)
  AUTHORS   Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
            Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
            McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
            Dunham,I., Hill,D.E. and Vidal,M.
  TITLE     hORFeome v3.1: a resource of human open reading frames representing
            over 10,000 human genes
  JOURNAL   Genomics 89 (3), 307-315 (2007)
   PUBMED   17207965
REFERENCE   3  (bases 1 to 1018)
  AUTHORS   Nukumi,N., Seki,M., Iwamori,T., Yada,T., Naito,K. and Tojo,H.
  TITLE     Analysis of the promoter of mutated human whey acidic protein (WAP)
            gene
  JOURNAL   J. Reprod. Dev. 52 (2), 315-320 (2006)
   PUBMED   16462094
  REMARK    GeneRIF: analysis of promoter of mutated human whey acidic protein
            (WAP) gene
REFERENCE   4  (bases 1 to 1018)
  AUTHORS   Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J.,
            Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B.,
            Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E.,
            Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S.,
            Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C.,
            Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V.,
            Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K.,
            Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z.,
            Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
  TITLE     The secreted protein discovery initiative (SPDI), a large-scale
            effort to identify novel human secreted and transmembrane proteins:
            a bioinformatics assessment
  JOURNAL   Genome Res. 13 (10), 2265-2270 (2003)
   PUBMED   12975309
  REMARK    Erratum:[Genome Res. 2003 Dec;13(12):2759]
REFERENCE   5  (bases 1 to 1018)
  AUTHORS   Clauss,A., Lilja,H. and Lundwall,A.
  TITLE     A locus on human chromosome 20 contains several genes expressing
            protease inhibitor domains with homology to whey acidic protein
  JOURNAL   Biochem. J. 368 (PT 1), 233-242 (2002)
   PUBMED   12206714
REFERENCE   6  (bases 1 to 1018)
  AUTHORS   Deloukas,P., Matthews,L.H., Ashurst,J., Burton,J., Gilbert,J.G.,
            Jones,M., Stavrides,G., Almeida,J.P., Babbage,A.K., Bagguley,C.L.,
            Bailey,J., Barlow,K.F., Bates,K.N., Beard,L.M., Beare,D.M.,
            Beasley,O.P., Bird,C.P., Blakey,S.E., Bridgeman,A.M., Brown,A.J.,
            Buck,D., Burrill,W., Butler,A.P., Carder,C., Carter,N.P.,
            Chapman,J.C., Clamp,M., Clark,G., Clark,L.N., Clark,S.Y.,
            Clee,C.M., Clegg,S., Cobley,V.E., Collier,R.E., Connor,R.,
            Corby,N.R., Coulson,A., Coville,G.J., Deadman,R., Dhami,P.,
            Dunn,M., Ellington,A.G., Frankland,J.A., Fraser,A., French,L.,
            Garner,P., Grafham,D.V., Griffiths,C., Griffiths,M.N., Gwilliam,R.,
            Hall,R.E., Hammond,S., Harley,J.L., Heath,P.D., Ho,S., Holden,J.L.,
            Howden,P.J., Huckle,E., Hunt,A.R., Hunt,S.E., Jekosch,K.,
            Johnson,C.M., Johnson,D., Kay,M.P., Kimberley,A.M., King,A.,
            Knights,A., Laird,G.K., Lawlor,S., Lehvaslaiho,M.H., Leversha,M.,
            Lloyd,C., Lloyd,D.M., Lovell,J.D., Marsh,V.L., Martin,S.L.,
            McConnachie,L.J., McLay,K., McMurray,A.A., Milne,S., Mistry,D.,
            Moore,M.J., Mullikin,J.C., Nickerson,T., Oliver,K., Parker,A.,
            Patel,R., Pearce,T.A., Peck,A.I., Phillimore,B.J.,
            Prathalingam,S.R., Plumb,R.W., Ramsay,H., Rice,C.M., Ross,M.T.,
            Scott,C.E., Sehra,H.K., Shownkeen,R., Sims,S., Skuce,C.D.,
            Smith,M.L., Soderlund,C., Steward,C.A., Sulston,J.E., Swann,M.,
            Sycamore,N., Taylor,R., Tee,L., Thomas,D.W., Thorpe,A., Tracey,A.,
            Tromans,A.C., Vaudin,M., Wall,M., Wallis,J.M., Whitehead,S.L.,
            Whittaker,P., Willey,D.L., Williams,L., Williams,S.A., Wilming,L.,
            Wray,P.W., Hubbard,T., Durbin,R.M., Bentley,D.R., Beck,S. and
            Rogers,J.
  TITLE     The DNA sequence and comparative analysis of human chromosome 20
  JOURNAL   Nature 414 (6866), 865-871 (2001)
   PUBMED   11780052
REFERENCE   7  (bases 1 to 1018)
  AUTHORS   Horikoshi,N., Cong,J., Kley,N. and Shenk,T.
  TITLE     Isolation of differentially expressed cDNAs from p53-dependent
            apoptotic cells: activation of the human homologue of the
            Drosophila peroxidasin gene
  JOURNAL   Biochem. Biophys. Res. Commun. 261 (3), 864-869 (1999)
   PUBMED   10441517
REFERENCE   8  (bases 1 to 1018)
  AUTHORS   Ranganathan,S., Simpson,K.J., Shaw,D.C. and Nicholas,K.R.
  TITLE     The whey acidic protein family: a new signature motif and
            three-dimensional structure by comparative modeling
  JOURNAL   J. Mol. Graph. Model. 17 (2), 106-113 (1999)
   PUBMED   10680116
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AY358822.1, BC039173.1 and
            Z93016.2.
            On Jun 18, 2011 this sequence version replaced gi:23238241.
            
            Summary: This gene encodes a member of the WAP-type four-disulfide
            core (WFDC) domain family. Most WFDC proteins contain only one WFDC
            domain, and this encoded protein contains two WFDC domains. The
            WFDC domain, or WAP signature motif, contains eight cysteines
            forming four disulfide bonds at the core of the protein, and
            functions as a protease inhibitor. Most WFDC gene members are
            localized to chromosome 20q12-q13 in two clusters: centromeric and
            telomeric. This gene belongs to the centromeric cluster. [provided
            by RefSeq, Jul 2008].
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY358822.1, BC039173.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025081, ERS025085 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-34                AY358822.1         1-34
            35-1002             BC039173.1         1-968
            1003-1018           Z93016.2           110236-110251       c
FEATURES             Location/Qualifiers
     source          1..1018
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="20"
                     /map="20q13.12"
     gene            1..1018
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /note="WAP four-disulfide core domain 5"
                     /db_xref="GeneID:149708"
                     /db_xref="HGNC:20477"
                     /db_xref="MIM:605161"
     exon            1..174
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(11..14)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace=""
                     /replace="ctga"
                     /db_xref="dbSNP:375288891"
     variation       complement(13..16)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace=""
                     /replace="gact"
                     /db_xref="dbSNP:147846563"
     variation       complement(45)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73910118"
     misc_feature    72..74
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /note="upstream in-frame stop codon"
     variation       complement(77)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371339713"
     variation       complement(78)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200540832"
     CDS             90..461
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /note="protease inhibitor WAP1; WAP four-disulfide core
                     domain protein 5; p53-responsive gene 5 protein; putative
                     protease inhibitor WAP1"
                     /codon_start=1
                     /product="WAP four-disulfide core domain protein 5
                     precursor"
                     /protein_id="NP_663627.1"
                     /db_xref="GI:21717822"
                     /db_xref="CCDS:CCDS33475.1"
                     /db_xref="GeneID:149708"
                     /db_xref="HGNC:20477"
                     /db_xref="MIM:605161"
                     /translation="
MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCYRACFRQCVPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARG
"
     sig_peptide     90..161
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     162..458
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /product="WAP four-disulfide core domain protein 5"
     misc_feature    273..452
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /note="whey acidic protein-type four-disulfide core
                     domains. Members of the family include whey acidic
                     protein, elafin (elastase-specific inhibitor),
                     caltrin-like protein (a calcium transport inhibitor) and
                     other extracellular proteinase inhibitors. A group of...;
                     Region: WAP; cd00199"
                     /db_xref="CDD:29256"
     misc_feature    321..341
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /note="inhibitory loop; inhibition site"
                     /db_xref="CDD:29256"
     variation       complement(92)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140685506"
     exon            175..315
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(182)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138962368"
     variation       complement(197)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111660564"
     variation       complement(220)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141103884"
     variation       complement(221)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114264609"
     variation       complement(237)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374696524"
     variation       complement(291)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142074298"
     variation       complement(292)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370436377"
     exon            316..456
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(342)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:116574899"
     variation       complement(349)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:114645401"
     variation       complement(354)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199500433"
     variation       complement(378)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17422688"
     variation       complement(397)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:79417830"
     variation       complement(422)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373684757"
     variation       complement(428)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145123781"
     variation       complement(429)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374180478"
     variation       complement(433)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139507452"
     variation       complement(442)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111992595"
     exon            457..1018
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(541)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199710758"
     variation       complement(543)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370593294"
     variation       complement(546)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373859109"
     variation       complement(568)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188147053"
     variation       complement(679)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79707292"
     variation       complement(682)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150516709"
     variation       complement(719)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184894433"
     variation       complement(740)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368455958"
     variation       complement(793)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6094096"
     variation       complement(801)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6031997"
     variation       complement(816)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6094095"
     variation       complement(846)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:180895744"
     variation       complement(870)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190510993"
     variation       complement(920)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6094094"
     variation       complement(927)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114781738"
     variation       complement(928)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112924458"
     variation       complement(943)
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:6130753"
     polyA_signal    985..990
                     /gene="WFDC5"
                     /gene_synonym="dJ211D12.5; PRG5; WAP1"
ORIGIN      
ctttcctctcctgactaagtttctctggcttccctgaggctgcaggtgttaatctggggggccctgggccctgagccggcagcagaaatatgaggacccagagccttctcctcctgggggccctcctggctgtggggagtcagctgcctgctgtctttggcaggaagaagggagagaaatcggggggctgcccgccagatgatgggccctgcctcctatcggtgcctgaccagtgcgtggaagacagccagtgtcccttgaccaggaagtgctgctacagagcttgcttccgccagtgtgtccccagggtctctgtgaagctgggcagctgcccagaggaccaactgcgctgcctcagccccatgaaccacctgtgtcacaaggactcagactgctcgggcaaaaagcgatgctgccacagcgcctgcgggcgggattgccgggatcctgccagaggctaattctgatttaggatctgtggctctgcacctaagctggggaccaacggaaagagttcacgatgggaggcctggggccctgcccgctggacagcactatctctaccagcggtggttccagccttctgataatcactggcctgctgacacttccctgcaacccatccacccctggtttctcctcctgggagtcaaagtccatagcctgagctcggaggaaggcctctgtatcaccccagtactctgcaccactgccatacgagcttcccacccttcctaacgctttcacaccaatccgtacatgctgcttcctccaccaaaaatgcccaattcaggcagaccctgacctctccctcaggcagcccaaccatccagaatgaatattcttgcagagttttccaaacatcagtcattcacctctttcatgattttcaccatacctacaaaatagcaccatgataggttgcacgctgcctgtaccaccatttacttaatgttttctttaaatggctcacttttgtatataaataaattcatttcaaaagaaaattgatatcact
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:149708 -> Molecular function: GO:0004867 [serine-type endopeptidase inhibitor activity] evidence: IEA
            GeneID:149708 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.