Home |
Help |
Advanced search
2025-11-18 00:01:32, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_006519 774 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens dynein, light chain, Tctex-type 1 (DYNLT1), mRNA.
ACCESSION NM_006519
VERSION NM_006519.2 GI:295842198
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 774)
AUTHORS Palmer,K.J., MacCarthy-Morrogh,L., Smyllie,N. and Stephens,D.J.
TITLE A role for Tctex-1 (DYNLT1) in controlling primary cilium length
JOURNAL Eur. J. Cell Biol. 90 (10), 865-871 (2011)
PUBMED 21700358
REMARK GeneRIF: A role for Tctex-1 (DYNLT1) in controlling primary cilium
length
REFERENCE 2 (bases 1 to 774)
AUTHORS Brault,J.B., Kudelko,M., Vidalain,P.O., Tangy,F., Despres,P. and
Pardigon,N.
TITLE The interaction of flavivirus M protein with light chain Tctex-1 of
human dynein plays a role in late stages of virus replication
JOURNAL Virology 417 (2), 369-378 (2011)
PUBMED 21767858
REMARK GeneRIF: These data show that Tctex-1 may play a role in late
stages of viral replication through its interaction with the
flavivirus membrane protein.
REFERENCE 3 (bases 1 to 774)
AUTHORS Ochiai,K., Watanabe,M., Ueki,H., Huang,P., Fujii,Y., Nasu,Y.,
Noguchi,H., Hirata,T., Sakaguchi,M., Huh,N.H., Kashiwakura,Y.,
Kaku,H. and Kumon,H.
TITLE Tumor suppressor REIC/Dkk-3 interacts with the dynein light chain,
Tctex-1
JOURNAL Biochem. Biophys. Res. Commun. 412 (2), 391-395 (2011)
PUBMED 21835165
REMARK GeneRIF: A link between REIC/Dkk- 3 and Tctex-1 may therefore be of
significance for understanding the molecular functions of the
proteins in ER stress signaling and the intracellular dynein motor
dynamics, respectively.
REFERENCE 4 (bases 1 to 774)
AUTHORS Fang,Y.D., Xu,X., Dang,Y.M., Zhang,Y.M., Zhang,J.P., Hu,J.Y.,
Zhang,Q., Dai,X., Teng,M., Zhang,D.X. and Huang,Y.S.
TITLE MAP4 mechanism that stabilizes mitochondrial permeability
transition in hypoxia: microtubule enhancement and DYNLT1
interaction with VDAC1
JOURNAL PLoS ONE 6 (12), E28052 (2011)
PUBMED 22164227
REMARK GeneRIF: there are two possible mechanisms triggered by MAP4:
stabilization of MT networks; DYNLT1 modulation, which is connected
with VDAC1, and inhibition of hypoxia-induced mitochondrial
permeabilization
REFERENCE 5 (bases 1 to 774)
AUTHORS Duguay,D., Belanger-Nelson,E., Mongrain,V., Beben,A.,
Khatchadourian,A. and Cermakian,N.
TITLE Dynein light chain Tctex-type 1 modulates orexin signaling through
its interaction with orexin 1 receptor
JOURNAL PLoS ONE 6 (10), E26430 (2011)
PUBMED 22028875
REMARK GeneRIF: Dynlt1 modulates orexin signaling by regulating OX1R
REFERENCE 6 (bases 1 to 774)
AUTHORS Mueller,S., Cao,X., Welker,R. and Wimmer,E.
TITLE Interaction of the poliovirus receptor CD155 with the dynein light
chain Tctex-1 and its implication for poliovirus pathogenesis
JOURNAL J. Biol. Chem. 277 (10), 7897-7904 (2002)
PUBMED 11751937
REMARK GeneRIF: Association with Tctex-1 and, hence, with the dynein motor
complex may offer an explanation for how poliovirus hijacks the
cellular transport machinery to retrogradely ascend along the axon
to the neuronal cell body.
REFERENCE 7 (bases 1 to 774)
AUTHORS Strovel,E.T., Wu,D. and Sussman,D.J.
TITLE Protein phosphatase 2Calpha dephosphorylates axin and activates
LEF-1-dependent transcription
JOURNAL J. Biol. Chem. 275 (4), 2399-2403 (2000)
PUBMED 10644691
REFERENCE 8 (bases 1 to 774)
AUTHORS Nagano,F., Orita,S., Sasaki,T., Naito,A., Sakaguchi,G., Maeda,M.,
Watanabe,T., Kominami,E., Uchiyama,Y. and Takai,Y.
TITLE Interaction of Doc2 with tctex-1, a light chain of cytoplasmic
dynein. Implication in dynein-dependent vesicle transport
JOURNAL J. Biol. Chem. 273 (46), 30065-30068 (1998)
PUBMED 9804756
REFERENCE 9 (bases 1 to 774)
AUTHORS King,S.M., Dillman,J.F. III, Benashski,S.E., Lye,R.J.,
Patel-King,R.S. and Pfister,K.K.
TITLE The mouse t-complex-encoded protein Tctex-1 is a light chain of
brain cytoplasmic dynein
JOURNAL J. Biol. Chem. 271 (50), 32281-32287 (1996)
PUBMED 8943288
REFERENCE 10 (bases 1 to 774)
AUTHORS Watanabe,T.K., Fujiwara,T., Shimizu,F., Okuno,S., Suzuki,M.,
Takahashi,E., Nakamura,Y. and Hirai,Y.
TITLE Cloning, expression, and mapping of TCTEL1, a putative human
homologue of murine Tcte1, to 6q
JOURNAL Cytogenet. Cell Genet. 73 (1-2), 153-156 (1996)
PUBMED 8646886
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AL589931.14, D50663.1 and BU675683.1.
On May 7, 2010 this sequence version replaced gi:5730084.
Summary: Cytoplasmic dynein is the major motor protein complex
responsible for minus-end, microtubule-based motile processes. Each
dynein complex consists of 2 heavy chains that have ATPase and
motor activities, plus a group of accessory polypeptides. TCTEX1 is
a dynein light chain involved in cargo binding (Chuang et al., 2005
[PubMed 15992542]).[supplied by OMIM, Mar 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BG035722.1, BG703409.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-52 AL589931.14 7964-8015 c
53-756 D50663.1 1-704
757-774 BU675683.1 1-18 c
FEATURES Location/Qualifiers
source 1..774
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="6"
/map="6q25.2-q25.3"
gene 1..774
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/note="dynein, light chain, Tctex-type 1"
/db_xref="GeneID:6993"
/db_xref="HGNC:11697"
/db_xref="HPRD:15987"
/db_xref="MIM:601554"
exon 1..91
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/inference="alignment:Splign:1.39.8"
misc_feature 5..7
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/note="upstream in-frame stop codon"
CDS 65..406
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/note="t-complex-associated-testis-expressed 1-like 1;
T-complex testis-specific protein 1 homolog"
/codon_start=1
/product="dynein light chain Tctex-type 1"
/protein_id="NP_006510.1"
/db_xref="GI:5730085"
/db_xref="CCDS:CCDS5257.1"
/db_xref="GeneID:6993"
/db_xref="HGNC:11697"
/db_xref="HPRD:15987"
/db_xref="MIM:601554"
/translation="
MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI
"
misc_feature 104..403
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/note="Tctex-1 family; Region: Tctex-1; pfam03645"
/db_xref="CDD:202715"
misc_feature 185..403
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P63172.1);
Region: Interaction with GNB1 (By similarity)"
exon 92..133
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/inference="alignment:Splign:1.39.8"
exon 134..257
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/inference="alignment:Splign:1.39.8"
exon 258..335
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/inference="alignment:Splign:1.39.8"
exon 336..759
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/inference="alignment:Splign:1.39.8"
STS 476..634
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/standard_name="A005A07"
/db_xref="UniSTS:5624"
STS 476..634
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/standard_name="G32210"
/db_xref="UniSTS:116817"
variation 528
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:1804639"
variation 645
/gene="DYNLT1"
/gene_synonym="CW-1; TCTEL1; tctex-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:1804638"
ORIGIN
ggcctgagtgcgcctgcgcagtccgcgccactcagggagccggaggggacgcgccggaggaaagatggaagactaccaggctgcggaggagactgcttttgttgttgatgaagtgagcaacattgtaaaagaggctatagaaagcgcaattggtggtaacgcttatcaacacagcaaagtgaaccagtggaccacaaatgtagtagaacaaactttaagccaactcaccaagctgggaaaaccatttaaatacatcgtgacctgtgtaattatgcagaagaatggagctggattacacacagcaagttcctgcttctgggacagctctactgacgggagctgcactgtgcgatgggagaataagaccatgtactgcatcgtcagtgccttcggactgtctatttgacctgcagtccagcctatggcctttctccttttgtctctagttcatcctctaaccaccagccatgaattcagtgaactcttttctcattctctttgttttgtggcactttcacaatgtagaggaaaaaaccaaatgaccgcactgtgatgtgaatggcaccgaagtcagatgagtatccctgtaggtcacctgcagcctgcgttgccacttgtcttaactctgaatatttcatttcaaaggtgctaaaatctgaaatctgctagtgtgaaacttgctctactctctgaaatgattcaaatacactaattttccatactttatacttttgttagaataaattattcaaatctaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:6993 -> Molecular function: GO:0003774 [motor activity] evidence: IEA
GeneID:6993 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:6993 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI
GeneID:6993 -> Biological process: GO:0000132 [establishment of mitotic spindle orientation] evidence: ISS
GeneID:6993 -> Biological process: GO:0007067 [mitosis] evidence: IEA
GeneID:6993 -> Biological process: GO:0008277 [regulation of G-protein coupled receptor protein signaling pathway] evidence: ISS
GeneID:6993 -> Biological process: GO:0019060 [intracellular transport of viral proteins in host cell] evidence: IMP
GeneID:6993 -> Biological process: GO:0032314 [regulation of Rac GTPase activity] evidence: IEA
GeneID:6993 -> Biological process: GO:0046718 [viral entry into host cell] evidence: IEA
GeneID:6993 -> Biological process: GO:0048812 [neuron projection morphogenesis] evidence: IEA
GeneID:6993 -> Biological process: GO:0050768 [negative regulation of neurogenesis] evidence: ISS
GeneID:6993 -> Biological process: GO:0051301 [cell division] evidence: IEA
GeneID:6993 -> Biological process: GO:0051493 [regulation of cytoskeleton organization] evidence: IEA
GeneID:6993 -> Biological process: GO:0075521 [microtubule-dependent intracellular transport of viral material to nucleus] evidence: IEA
GeneID:6993 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IEA
GeneID:6993 -> Cellular component: GO:0005819 [spindle] evidence: IEA
GeneID:6993 -> Cellular component: GO:0005868 [cytoplasmic dynein complex] evidence: ISS
GeneID:6993 -> Cellular component: GO:0005874 [microtubule] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.