GGRNA Home | Help | Advanced search

2025-10-14 15:24:40, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001193333            1943 bp    mRNA    linear   PRI 15-JUN-2013
DEFINITION  Homo sapiens coronin, actin binding protein, 1A (CORO1A),
            transcript variant 1, mRNA.
ACCESSION   NM_001193333
VERSION     NM_001193333.2  GI:306482594
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1943)
  AUTHORS   Oku,T., Nakano,M., Kaneko,Y., Ando,Y., Kenmotsu,H., Itoh,S.,
            Tsuiji,M., Seyama,Y., Toyoshima,S. and Tsuji,T.
  TITLE     Constitutive turnover of phosphorylation at Thr-412 of human
            p57/coronin-1 regulates the interaction with actin
  JOURNAL   J. Biol. Chem. 287 (51), 42910-42920 (2012)
   PUBMED   23100250
  REMARK    GeneRIF: Constitutive turnover of phosphorylation at Thr-412 of
            p57/coronin-1 regulates its interaction with actin.
REFERENCE   2  (bases 1 to 1943)
  AUTHORS   Castro-Castro,A., Ojeda,V., Barreira,M., Sauzeau,V.,
            Navarro-Lerida,I., Muriel,O., Couceiro,J.R., Pimentel-Muinos,F.X.,
            Del Pozo,M.A. and Bustelo,X.R.
  TITLE     Coronin 1A promotes a cytoskeletal-based feedback loop that
            facilitates Rac1 translocation and activation
  JOURNAL   EMBO J. 30 (19), 3913-3927 (2011)
   PUBMED   21873980
  REMARK    GeneRIF: Coronin 1A promotes a cytoskeletal-based feedback loop
            that facilitates Rac1 translocation and activation
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1943)
  AUTHORS   Mueller,P., Liu,X. and Pieters,J.
  TITLE     Migration and homeostasis of naive T cells depends on coronin
            1-mediated prosurvival signals and not on coronin 1-dependent
            filamentous actin modulation
  JOURNAL   J. Immunol. 186 (7), 4039-4050 (2011)
   PUBMED   21339362
  REMARK    GeneRIF: Instead of regulating the F-actin cytoskeleton, coronin 1
            functions in balancing pro- and antiapoptotic signals by regulating
            divalent calcium ion fluxes and calcineurin activation downstream
            of the T cell receptor.
REFERENCE   4  (bases 1 to 1943)
  AUTHORS   Moriceau,S., Kantari,C., Mocek,J., Davezac,N., Gabillet,J.,
            Guerrera,I.C., Brouillard,F., Tondelier,D., Sermet-Gaudelus,I.,
            Danel,C., Lenoir,G., Daniel,S., Edelman,A. and Witko-Sarsat,V.
  TITLE     Coronin-1 is associated with neutrophil survival and is cleaved
            during apoptosis: potential implication in neutrophils from cystic
            fibrosis patients
  JOURNAL   J. Immunol. 182 (11), 7254-7263 (2009)
   PUBMED   19454722
  REMARK    GeneRIF: Circulating neutrophils from CF patients had more
            coronin-1 expression, associated with a lower apoptosis rate
REFERENCE   5  (bases 1 to 1943)
  AUTHORS   Shiow,L.R., Roadcap,D.W., Paris,K., Watson,S.R., Grigorova,I.L.,
            Lebet,T., An,J., Xu,Y., Jenne,C.N., Foger,N., Sorensen,R.U.,
            Goodnow,C.C., Bear,J.E., Puck,J.M. and Cyster,J.G.
  TITLE     The actin regulator coronin 1A is mutant in a thymic
            egress-deficient mouse strain and in a patient with severe combined
            immunodeficiency
  JOURNAL   Nat. Immunol. 9 (11), 1307-1315 (2008)
   PUBMED   18836449
  REMARK    GeneRIF: Findings establish a function for coronin 1A in T cell
            egress, identify a surface of coronin involved in Arp2/3
            regulation.
REFERENCE   6  (bases 1 to 1943)
  AUTHORS   Vanguri,V.K., Wang,S., Godyna,S., Ranganathan,S. and Liau,G.
  TITLE     Thrombospondin-1 binds to polyhistidine with high affinity and
            specificity
  JOURNAL   Biochem. J. 347 (PT 2), 469-473 (2000)
   PUBMED   10749676
REFERENCE   7  (bases 1 to 1943)
  AUTHORS   Ferrari,G., Langen,H., Naito,M. and Pieters,J.
  TITLE     A coat protein on phagosomes involved in the intracellular survival
            of mycobacteria
  JOURNAL   Cell 97 (4), 435-447 (1999)
   PUBMED   10338208
REFERENCE   8  (bases 1 to 1943)
  AUTHORS   Okumura,M., Kung,C., Wong,S., Rodgers,M. and Thomas,M.L.
  TITLE     Definition of family of coronin-related proteins conserved between
            humans and mice: close genetic linkage between coronin-2 and
            CD45-associated protein
  JOURNAL   DNA Cell Biol. 17 (9), 779-787 (1998)
   PUBMED   9778037
REFERENCE   9  (bases 1 to 1943)
  AUTHORS   Grogan,A., Reeves,E., Keep,N., Wientjes,F., Totty,N.F.,
            Burlingame,A.L., Hsuan,J.J. and Segal,A.W.
  TITLE     Cytosolic phox proteins interact with and regulate the assembly of
            coronin in neutrophils
  JOURNAL   J. Cell. Sci. 110 (PT 24), 3071-3081 (1997)
   PUBMED   9365277
REFERENCE   10 (bases 1 to 1943)
  AUTHORS   Suzuki,K., Nishihata,J., Arai,Y., Honma,N., Yamamoto,K., Irimura,T.
            and Toyoshima,S.
  TITLE     Molecular cloning of a novel actin-binding protein, p57, with a WD
            repeat and a leucine zipper motif
  JOURNAL   FEBS Lett. 364 (3), 283-288 (1995)
   PUBMED   7758584
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DC408372.1, DA256300.1,
            AK314714.1, U34690.1 and BC110374.1.
            On Sep 9, 2010 this sequence version replaced gi:300934761.
            
            Summary: This gene encodes a member of the WD repeat protein
            family. WD repeats are minimally conserved regions of approximately
            40 amino acids typically bracketed by gly-his and trp-asp (GH-WD),
            which may facilitate formation of heterotrimeric or multiprotein
            complexes. Members of this family are involved in a variety of
            cellular processes, including cell cycle progression, signal
            transduction, apoptosis, and gene regulation. Alternative splicing
            results in multiple transcript variants. A related pseudogene has
            been defined on chromosome 16. [provided by RefSeq, Sep 2010].
            
            Transcript Variant: This variant (1) represents the longer
            transcript. Both variants 1 and 2 encode the same protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK314714.1 [ECO:0000332]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-109               DC408372.1         1-109
            110-199             DA256300.1         98-187
            200-770             AK314714.1         1-571
            771-771             U34690.1           428-428
            772-1821            AK314714.1         573-1622
            1822-1943           BC110374.1         1521-1642
FEATURES             Location/Qualifiers
     source          1..1943
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="16"
                     /map="16p11.2"
     gene            1..1943
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="coronin, actin binding protein, 1A"
                     /db_xref="GeneID:11151"
                     /db_xref="HGNC:2252"
                     /db_xref="MIM:605000"
     exon            1..316
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       110
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:930392"
     variation       224
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:186185074"
     STS             249..1898
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /db_xref="UniSTS:486443"
     variation       284
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11555340"
     STS             297..1860
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /db_xref="UniSTS:494834"
     exon            317..434
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       380
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372973829"
     misc_feature    385..387
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="upstream in-frame stop codon"
     exon            435..633
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     CDS             436..1821
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="coronin-1; clipin-A; coronin-like protein A;
                     coronin-like protein p57; tryptophan aspartate-containing
                     coat protein"
                     /codon_start=1
                     /product="coronin-1A"
                     /protein_id="NP_001180262.1"
                     /db_xref="GI:300934762"
                     /db_xref="CCDS:CCDS10673.1"
                     /db_xref="GeneID:11151"
                     /db_xref="HGNC:2252"
                     /db_xref="MIM:605000"
                     /translation="
MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
"
     misc_feature    439..441
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N-acetylserine; propagated from
                     UniProtKB/Swiss-Prot (P31146.4); acetylation site"
     misc_feature    439..441
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by PKC; propagated from
                     UniProtKB/Swiss-Prot (P31146.4); phosphorylation site"
     misc_feature    445..639
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="Domain of unknown function (DUF1899); Region:
                     DUF1899; pfam08953"
                     /db_xref="CDD:149883"
     misc_feature    460..1818
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="coronin; Provisional; Region: PTZ00421"
                     /db_xref="CDD:173611"
     misc_feature    472..624
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 1"
     misc_feature    652..765
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 2"
     misc_feature    661..1341
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cl02567"
                     /db_xref="CDD:207648"
     misc_feature    order(670..675,730..732,742..744,760..765,820..825,
                     877..879,892..894,910..915,958..960,1009..1011,1024..1026,
                     1042..1047,1093..1095,1141..1143,1165..1167,1183..1188,
                     1222..1224,1231..1233,1285..1287,1300..1302,1318..1323)
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="structural tetrad; other site"
                     /db_xref="CDD:29257"
     misc_feature    802..915
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 3"
     misc_feature    925..1047
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 4"
     misc_feature    1054..1188
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 5"
     misc_feature    1207..1611
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="Domain of unknown function (DUF1900); Region:
                     DUF1900; pfam08954"
                     /db_xref="CDD:149884"
     misc_feature    1207..1323
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 6"
     misc_feature    1339..1482
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 7"
     misc_feature    1669..1671
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine, by PKC; propagated from
                     UniProtKB/Swiss-Prot (P31146.4); phosphorylation site"
     misc_feature    1780..1782
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine; propagated from
                     UniProtKB/Swiss-Prot (P31146.4); acetylation site"
     variation       489
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61736363"
     variation       517
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201747422"
     variation       554
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:79062603"
     variation       603
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75142051"
     exon            634..756
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       656
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373022238"
     variation       672
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201766395"
     variation       673
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11555342"
     variation       708
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141844867"
     variation       720
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184262856"
     variation       754
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201579444"
     exon            757..886
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       771
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1132812"
     variation       781
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138146826"
     variation       796
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370896577"
     variation       802
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201721540"
     variation       804
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200437355"
     variation       807
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149599538"
     variation       808
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143294920"
     variation       825
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201119953"
     exon            887..1071
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       929
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371653086"
     variation       930
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374849081"
     variation       954
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199752871"
     variation       975
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369595327"
     variation       992
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148312916"
     variation       996
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141746241"
     variation       1039
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145989561"
     variation       1065
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139989282"
     variation       1066
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371818902"
     exon            1072..1191
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       1081
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377504027"
     variation       1084
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:141827038"
     variation       1119
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371077364"
     variation       1146
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374088140"
     variation       1173
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143729497"
     variation       1179
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200060318"
     exon            1192..1296
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       1209
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187747730"
     variation       1211
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200963965"
     variation       1227
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139024575"
     variation       1239
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149867063"
     variation       1272
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113875403"
     variation       1278
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199650298"
     exon            1297..1442
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       1371
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148629867"
     variation       1380
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144860668"
     variation       1389
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376912665"
     variation       1431
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199960741"
     STS             1434..1571
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /standard_name="RH47208"
                     /db_xref="UniSTS:88686"
     variation       1437
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377351892"
     exon            1443..1500
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       1462
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:112289496"
     variation       1467
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199896375"
     exon            1501..1716
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       1509
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376540649"
     variation       1512
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147924993"
     variation       1532
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150857828"
     variation       1536
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139282852"
     variation       1581
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201734831"
     variation       1583
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61736366"
     variation       1596
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375181897"
     variation       1607
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375532115"
     variation       1623
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151106018"
     variation       1624
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35967690"
     variation       1639
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150186033"
     variation       1645
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11555339"
     variation       1649
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369828613"
     variation       1657
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373093101"
     variation       1668
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138821284"
     variation       1674
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199576607"
     variation       1679
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1804109"
     exon            1717..1933
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       1762
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1053574"
     variation       1779
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3209337"
     polyA_signal    1909..1914
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
     polyA_site      1933
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
ORIGIN      
aaaaagaagtttagattcgcttcccggagccgggatggcagcctgcgctatggttggggaccaacgtggtgcacgggcaggggccggggagagaggcggccgcagcgggagcccgggagcgcagggcgggcctggaagagctccgccccaaggggcgcggccaccccggaggcgggcgcacggctgcttctcattcattgtcttgacaagagcatcttcagcgggcgagtccccggctcctccagctccttcctcctcttcctcctcctcctccacctccggcttttgggggatcactgtcctctctcggcagcagatacaggctgctcctcaagactggggctcttcacatacgctcctcaccgctctttgggcaggccgacctagcagcctcttcgggagtcctggggtggccgggggtgctggagcccccaaatgagccggcaggtggtccgctccagcaagttccgccacgtgtttggacagccggccaaggccgaccagtgctatgaagatgtgcgcgtctcacagaccacctgggacagtggcttctgtgctgtcaaccctaagtttgtggccctgatctgtgaggccagcgggggaggggccttcctggtgctgcccctgggcaagactggacgtgtggacaagaatgcgcccacggtctgtggccacacagcccctgtgctagacatcgcctggtgcccgcacaatgacaacgtcattgccagtggctccgaggactgcacagtcatggtgtgggagatcccagatgggggcctgatgctgcccctgcgggagcccgtcgtcaccctggagggccacaccaagcgtgtgggcattgtggcctggcacaccacagcccagaacgtgctgctcagtgcaggttgtgacaacgtgatcatggtgtgggacgtgggcactggggcggccatgctgacactgggcccagaggtgcacccagacacgatctacagtgtggactggagccgagatggaggcctcatttgtacctcctgccgtgacaagcgcgtgcgcatcatcgagccccgcaaaggcactgtcgtagctgagaaggaccgtccccacgaggggacccggcccgtgcgtgcagtgttcgtgtcggaggggaagatcctgaccacgggcttcagccgcatgagtgagcggcaggtggcgctgtgggacacaaagcacctggaggagccgctgtccctgcaggagctggacaccagcagcggtgtcctgctgcccttctttgaccctgacaccaacatcgtctacctctgtggcaagggtgacagctcaatccggtactttgagatcacttccgaggcccctttcctgcactatctctccatgttcagttccaaggagtcccagcggggcatgggctacatgcccaaacgtggcctggaggtgaacaagtgtgagatcgccaggttctacaagctgcacgagcggaggtgtgagcccattgccatgacagtgcctcgaaagtcggacctgttccaggaggacctgtacccacccaccgcagggcccgaccctgccctcacggctgaggagtggctggggggtcgggatgctgggcccctcctcatctccctcaaggatggctacgtacccccaaagagccgggagctgagggtcaaccggggcctggacaccgggcgcaggagggcagcaccagaggccagtggcactcccagctcggatgccgtgtctcggctggaggaggagatgcggaagctccaggccacggtgcaggagctccagaagcgcttggacaggctggaggagacagtccaggccaagtagagccccgcagggcctccagcagggtcagccattcacacccatccactcacctcccattcccagccacatggcagagaaaaaaatcataataaaatggctttattttctggtaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:11151 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:11151 -> Molecular function: GO:0008022 [protein C-terminus binding] evidence: IPI
            GeneID:11151 -> Molecular function: GO:0008092 [cytoskeletal protein binding] evidence: ISS
            GeneID:11151 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IDA
            GeneID:11151 -> Molecular function: GO:0043548 [phosphatidylinositol 3-kinase binding] evidence: IDA
            GeneID:11151 -> Molecular function: GO:0051015 [actin filament binding] evidence: IDA
            GeneID:11151 -> Biological process: GO:0001845 [phagolysosome assembly] evidence: IMP
            GeneID:11151 -> Biological process: GO:0006816 [calcium ion transport] evidence: IEA
            GeneID:11151 -> Biological process: GO:0006909 [phagocytosis] evidence: IMP
            GeneID:11151 -> Biological process: GO:0006928 [cellular component movement] evidence: NAS
            GeneID:11151 -> Biological process: GO:0007015 [actin filament organization] evidence: IEA
            GeneID:11151 -> Biological process: GO:0008360 [regulation of cell shape] evidence: IBA
            GeneID:11151 -> Biological process: GO:0030036 [actin cytoskeleton organization] evidence: IMP
            GeneID:11151 -> Biological process: GO:0030335 [positive regulation of cell migration] evidence: IEA
            GeneID:11151 -> Biological process: GO:0030595 [leukocyte chemotaxis] evidence: IBA
            GeneID:11151 -> Biological process: GO:0030833 [regulation of actin filament polymerization] evidence: IEA
            GeneID:11151 -> Biological process: GO:0031589 [cell-substrate adhesion] evidence: IMP
            GeneID:11151 -> Biological process: GO:0032796 [uropod organization] evidence: IBA
            GeneID:11151 -> Biological process: GO:0042102 [positive regulation of T cell proliferation] evidence: IEA
            GeneID:11151 -> Biological process: GO:0043029 [T cell homeostasis] evidence: IEA
            GeneID:11151 -> Biological process: GO:0045087 [innate immune response] evidence: NAS
            GeneID:11151 -> Biological process: GO:0048873 [homeostasis of number of cells within a tissue] evidence: IEA
            GeneID:11151 -> Biological process: GO:0050918 [positive chemotaxis] evidence: IDA
            GeneID:11151 -> Biological process: GO:0051126 [negative regulation of actin nucleation] evidence: IDA
            GeneID:11151 -> Biological process: GO:0071353 [cellular response to interleukin-4] evidence: IEA
            GeneID:11151 -> Cellular component: GO:0001772 [immunological synapse] evidence: IEA
            GeneID:11151 -> Cellular component: GO:0001891 [phagocytic cup] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0005884 [actin filament] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0030027 [lamellipodium] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0030670 [phagocytic vesicle membrane] evidence: IEA
            GeneID:11151 -> Cellular component: GO:0030864 [cortical actin cytoskeleton] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0043234 [protein complex] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0045335 [phagocytic vesicle] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.