Home |
Help |
Advanced search
2025-11-08 11:27:25, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_130769 774 bp mRNA linear PRI 13-APR-2013
DEFINITION Homo sapiens glycoprotein hormone alpha 2 (GPHA2), mRNA.
ACCESSION NM_130769
VERSION NM_130769.3 GI:189491650
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 774)
AUTHORS Okajima,Y., Nagasaki,H., Suzuki,C., Suga,H., Ozaki,N., Arima,H.,
Hamada,Y., Civelli,O. and Oiso,Y.
TITLE Biochemical roles of the oligosaccharide chains in thyrostimulin, a
heterodimeric hormone of glycoprotein hormone subunits alpha 2
(GPA2) and beta 5 (GPB5)
JOURNAL Regul. Pept. 148 (1-3), 62-67 (2008)
PUBMED 18433898
REMARK GeneRIF: Dual site-disrupted GPA2 and the GPB5 mutant were not
expressed in either the conditioned medium or cell lysate.
REFERENCE 2 (bases 1 to 774)
AUTHORS Suzuki,C., Nagasaki,H., Okajima,Y., Suga,H., Arima,H., Iwasaki,Y.
and Oiso,Y.
TITLE The LIM domain homeobox gene isl-1 is a positive regulator of
glycoprotein alpha 2 (GPA2), a subunit of thyrostimulin
JOURNAL Regul. Pept. 142 (1-2), 60-67 (2007)
PUBMED 17363077
REMARK GeneRIF: Sudy illustrated that GPA2 is positively regulated by
isl-1, suggesting that this protein associates with endocrine
systems including the pituitary and pancreas.
REFERENCE 3 (bases 1 to 774)
AUTHORS Breous,E., Wenzel,A. and Loos,U.
TITLE Promoter cloning and characterisation of the transcriptional
regulation of the human thyrostimulin A2 subunit
JOURNAL Mol. Cell. Endocrinol. 245 (1-2), 169-180 (2005)
PUBMED 16376481
REMARK GeneRIF: cloning and functional analysis of the promoter of the
thyrostimulin A2 subunit
REFERENCE 4 (bases 1 to 774)
AUTHORS Sudo,S., Kuwabara,Y., Park,J.I., Hsu,S.Y. and Hsueh,A.J.
TITLE Heterodimeric fly glycoprotein hormone-alpha2 (GPA2) and
glycoprotein hormone-beta5 (GPB5) activate fly leucine-rich
repeat-containing G protein-coupled receptor-1 (DLGR1) and
stimulation of human thyrotropin receptors by chimeric fly GPA2 and
human GPB5
JOURNAL Endocrinology 146 (8), 3596-3604 (2005)
PUBMED 15890769
REMARK GeneRIF: GPA2, and another beta-subunit, GPB5, in human, are
capable of forming heterodimers to activate TSH receptors.
REFERENCE 5 (bases 1 to 774)
AUTHORS Hsu,S.Y., Nakabayashi,K. and Bhalla,A.
TITLE Evolution of glycoprotein hormone subunit genes in bilateral
metazoa: identification of two novel human glycoprotein hormone
subunit family genes, GPA2 and GPB5
JOURNAL Mol. Endocrinol. 16 (7), 1538-1551 (2002)
PUBMED 12089349
REMARK GeneRIF: identification and characterization of GPA2 genes
REFERENCE 6 (bases 1 to 774)
AUTHORS Nakabayashi,K., Matsumi,H., Bhalla,A., Bae,J., Mosselman,S.,
Hsu,S.Y. and Hsueh,A.J.
TITLE Thyrostimulin, a heterodimer of two new human glycoprotein hormone
subunits, activates the thyroid-stimulating hormone receptor
JOURNAL J. Clin. Invest. 109 (11), 1445-1452 (2002)
PUBMED 12045258
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AF260739.1 and AP001187.5.
On Jun 7, 2008 this sequence version replaced gi:24475778.
Summary: GPHA2 is a cystine knot-forming polypeptide and a subunit
of the dimeric glycoprotein hormone family (Hsu et al., 2002
[PubMed 12089349]).[supplied by OMIM, Mar 2008].
##Evidence-Data-START##
Transcript exon combination :: AF260739.1, BI839000.1 [ECO:0000332]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-489 AF260739.1 1-489
490-490 AP001187.5 140528-140528 c
491-774 AF260739.1 491-774
FEATURES Location/Qualifiers
source 1..774
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11q13.1"
gene 1..774
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/note="glycoprotein hormone alpha 2"
/db_xref="GeneID:170589"
/db_xref="HGNC:18054"
/db_xref="HPRD:17052"
/db_xref="MIM:609651"
exon 1..55
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/inference="alignment:Splign:1.39.8"
STS 6..495
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/db_xref="UniSTS:481495"
STS 26..476
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/db_xref="UniSTS:483682"
CDS 56..445
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/note="cysteine knot protein; glycoprotein alpha 2;
glycoprotein hormone alpha-2; thyrostimulin subunit alpha;
putative secreted protein Zsig51"
/codon_start=1
/product="glycoprotein hormone alpha-2 precursor"
/protein_id="NP_570125.1"
/db_xref="GI:18640742"
/db_xref="CCDS:CCDS8086.1"
/db_xref="GeneID:170589"
/db_xref="HGNC:18054"
/db_xref="HPRD:17052"
/db_xref="MIM:609651"
/translation="
MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY
"
sig_peptide 56..124
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 125..442
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/product="Glycoprotein hormone alpha-2"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q96T91.1)"
exon 56..158
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/inference="alignment:Splign:1.39.8"
exon 159..343
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/inference="alignment:Splign:1.39.8"
exon 344..747
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/inference="alignment:Splign:1.39.8"
variation 490
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/replace="a"
/replace="g"
/db_xref="dbSNP:673995"
variation 496
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/replace="g"
/replace="t"
/db_xref="dbSNP:1055112"
variation 648
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/replace="c"
/replace="t"
/db_xref="dbSNP:3168083"
variation 654
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/replace="c"
/replace="t"
/db_xref="dbSNP:3178482"
variation 678
/gene="GPHA2"
/gene_synonym="A2; GPA2; ZSIG51"
/replace="c"
/replace="t"
/db_xref="dbSNP:3178483"
ORIGIN
ccagcaggaggcacaggaaaactgcaagccgctctgttcctgggcctcggaagtgatgcctatggcgtcccctcaaaccctggtcctctatctgctggtcctggcagtcactgaagcctggggccaggaggcagtcatcccaggctgccacttgcaccccttcaatgtgacagtgcgaagtgaccgccaaggcacctgccagggctcccacgtggcacaggcctgtgtgggccactgtgagtccagcgccttcccttctcggtactctgtgctggtggccagtggttaccgacacaacatcacctccgtctctcagtgctgcaccatcagtggcctgaagaaggtcaaagtacagctgcagtgtgtggggagccggagggaggagctcgagatcttcacggccagggcctgccagtgtgacatgtgtcgcctctctcgctactagcccatcctctcccctccttcctcccctgggtcacagggcttgacgttctggtgggggaaacctgtgttcaagattcaaaaactggaaggagctccagccctgatggttacttgctatggaatttttttaaataaggggagggttgttccagctttgatcctttgtaagattttgtgactgtcacctgagaagaggggagtttctgcttcttccctgcctctgcctggcccttctaaaccaatctttcatcattttacttccctctttgcccttacccctaaataaagcaagcagttcttgaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:170589 -> Molecular function: GO:0005179 [hormone activity] evidence: IEA
GeneID:170589 -> Cellular component: GO:0005576 [extracellular region] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.