GGRNA Home | Help | Advanced search

2025-09-16 06:01:23, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_001265               2370 bp    mRNA    linear   PRI 08-JUL-2013
DEFINITION  Homo sapiens caudal type homeobox 2 (CDX2), mRNA.
ACCESSION   NM_001265
VERSION     NM_001265.4  GI:372624391
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2370)
  AUTHORS   Raghoebir,L., Biermann,K., Buscop-van Kempen,M., Wijnen,R.M.,
            Tibboel,D., Smits,R. and Rottier,R.J.
  TITLE     Disturbed balance between SOX2 and CDX2 in human vitelline duct
            anomalies and intestinal duplications
  JOURNAL   Virchows Arch. 462 (5), 515-522 (2013)
   PUBMED   23568430
  REMARK    GeneRIF: data indicate that a fine balance between SOX2 and CDX2
            expression in the gastrointestinal tract is essential for proper
            development
REFERENCE   2  (bases 1 to 2370)
  AUTHORS   Chang,D.K., Jamieson,N.B., Johns,A.L., Scarlett,C.J., Pajic,M.,
            Chou,A., Pinese,M., Humphris,J.L., Jones,M.D., Toon,C.,
            Nagrial,A.M., Chantrill,L.A., Chin,V.T., Pinho,A.V., Rooman,I.,
            Cowley,M.J., Wu,J., Mead,R.S., Colvin,E.K., Samra,J.S., Corbo,V.,
            Bassi,C., Falconi,M., Lawlor,R.T., Crippa,S., Sperandio,N.,
            Bersani,S., Dickson,E.J., Mohamed,M.A., Oien,K.A., Foulis,A.K.,
            Musgrove,E.A., Sutherland,R.L., Kench,J.G., Carter,C.R., Gill,A.J.,
            Scarpa,A., McKay,C.J. and Biankin,A.V.
  TITLE     Histomolecular phenotypes and outcome in adenocarcinoma of the
            ampulla of vater
  JOURNAL   J. Clin. Oncol. 31 (10), 1348-1356 (2013)
   PUBMED   23439753
  REMARK    GeneRIF: Data indicate that histologic subtype and CDX2 and MUC1
            expression were significant prognostic variables.
REFERENCE   3  (bases 1 to 2370)
  AUTHORS   Hong,K.D., Lee,D., Lee,Y., Lee,S.I. and Moon,H.Y.
  TITLE     Reduced CDX2 expression predicts poor overall survival in patients
            with colorectal cancer
  JOURNAL   Am Surg 79 (4), 353-360 (2013)
   PUBMED   23574843
  REMARK    GeneRIF: Reduced CDX2 expression is associated with poor overall
            survical in patients with colorectal cancer and may be clinically
            useful as a marker for poor prognosis.
REFERENCE   4  (bases 1 to 2370)
  AUTHORS   Goto,Y., Kato,T., Ando,T., Goto,H. and Hamajima,N.
  TITLE     No association between the CDX2 G543C polymorphism and risk of
            gastric atrophy and cancer
  JOURNAL   Asian Pac. J. Cancer Prev. 13 (11), 5691-5694 (2012)
   PUBMED   23317240
  REMARK    GeneRIF: No association between the CDX2 G543C polymorphism was
            found in gastric atrophy and cancer.
REFERENCE   5  (bases 1 to 2370)
  AUTHORS   Drummond,F., Putt,W., Fox,M. and Edwards,Y.H.
  TITLE     Cloning and chromosome assignment of the human CDX2 gene
  JOURNAL   Ann. Hum. Genet. 61 (PT 5), 393-400 (1997)
   PUBMED   9459001
REFERENCE   6  (bases 1 to 2370)
  AUTHORS   Chawengsaksophak,K., James,R., Hammond,V.E., Kontgen,F. and Beck,F.
  TITLE     Homeosis and intestinal tumours in Cdx2 mutant mice
  JOURNAL   Nature 386 (6620), 84-87 (1997)
   PUBMED   9052785
REFERENCE   7  (bases 1 to 2370)
  AUTHORS   Mallo,G.V., Rechreche,H., Frigerio,J.M., Rocha,D., Zweibaum,A.,
            Lacasa,M., Jordan,B.R., Dusetti,N.J., Dagorn,J.C. and Iovanna,J.L.
  TITLE     Molecular cloning, sequencing and expression of the mRNA encoding
            human Cdx1 and Cdx2 homeobox. Down-regulation of Cdx1 and Cdx2 mRNA
            expression during colorectal carcinogenesis
  JOURNAL   Int. J. Cancer 74 (1), 35-44 (1997)
   PUBMED   9036867
REFERENCE   8  (bases 1 to 2370)
  AUTHORS   Inoue,H., Riggs,A.C., Tanizawa,Y., Ueda,K., Kuwano,A., Liu,L.,
            Donis-Keller,H. and Permutt,M.A.
  TITLE     Isolation, characterization, and chromosomal mapping of the human
            insulin promoter factor 1 (IPF-1) gene
  JOURNAL   Diabetes 45 (6), 789-794 (1996)
   PUBMED   8635654
REFERENCE   9  (bases 1 to 2370)
  AUTHORS   German,M.S., Wang,J., Fernald,A.A., Espinosa,R. III, Le Beau,M.M.
            and Bell,G.I.
  TITLE     Localization of the genes encoding two transcription factors, LMX1
            and CDX3, regulating insulin gene expression to human chromosomes 1
            and 13
  JOURNAL   Genomics 24 (2), 403-404 (1994)
   PUBMED   7698771
REFERENCE   10 (bases 1 to 2370)
  AUTHORS   Suh,E., Chen,L., Taylor,J. and Traber,P.G.
  TITLE     A homeodomain protein related to caudal regulates
            intestine-specific gene transcription
  JOURNAL   Mol. Cell. Biol. 14 (11), 7340-7351 (1994)
   PUBMED   7935448
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL591024.14, BC014461.1 and
            BI085425.1.
            On Jan 19, 2012 this sequence version replaced gi:169636434.
            
            Summary: This gene is a member of the caudal-related homeobox
            transcription factor gene family. The encoded protein is a major
            regulator of intestine-specific genes involved in cell growth an
            differentiation. This protein also plays a role in early embryonic
            development of the intestinal tract. Aberrant expression of this
            gene is associated with intestinal inflammation and tumorigenesis.
            [provided by RefSeq, Jan 2012].
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: Y13709.1, BC014461.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025094 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-188               AL591024.14        27157-27344         c
            189-1313            BC014461.1         1-1125
            1314-2278           AL591024.14        20117-21081         c
            2279-2370           BI085425.1         278-369
FEATURES             Location/Qualifiers
     source          1..2370
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="13"
                     /map="13q12.3"
     gene            1..2370
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /note="caudal type homeobox 2"
                     /db_xref="GeneID:1045"
                     /db_xref="HGNC:1806"
                     /db_xref="MIM:600297"
     exon            1..903
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    42..44
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /note="upstream in-frame stop codon"
     variation       351
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1050194"
     CDS             363..1304
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /note="caudal type homeobox transcription factor 2; caudal
                     type homeo box transcription factor 2; caudal-type
                     homeobox protein 2"
                     /codon_start=1
                     /product="homeobox protein CDX-2"
                     /protein_id="NP_001256.3"
                     /db_xref="GI:372624392"
                     /db_xref="CCDS:CCDS9328.1"
                     /db_xref="GeneID:1045"
                     /db_xref="HGNC:1806"
                     /db_xref="MIM:600297"
                     /translation="
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ
"
     misc_feature    399..902
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /note="Caudal like protein activation region; Region:
                     Caudal_act; pfam04731"
                     /db_xref="CDD:147075"
     misc_feature    924..1091
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(924..935,939..941,990..992,1008..1010,1047..1049,
                     1053..1058,1065..1070,1074..1082,1086..1091)
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(927..929,936..938,1056..1058,1065..1070,1077..1079)
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     variation       545
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1805106"
     variation       807
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:77186314"
     exon            904..1049
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /inference="alignment:Splign:1.39.8"
     exon            1050..2351
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /inference="alignment:Splign:1.39.8"
     variation       1181
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1050196"
     variation       1239
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1805107"
     variation       1314
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1805108"
     STS             1323..1466
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /standard_name="STS-U51096"
                     /db_xref="UniSTS:52671"
     variation       1389
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202146369"
     variation       1586
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372032016"
     STS             1991..2141
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
                     /standard_name="RH48331"
                     /db_xref="UniSTS:11728"
     polyA_site      2278
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
     polyA_site      2351
                     /gene="CDX2"
                     /gene_synonym="CDX-3; CDX3"
ORIGIN      
ctccaaccattggtgtctgtgtcattactaatagagtcttgtaaacactcgttaatcacggaaggccgccggcctggggctccgcacgccagcctgtggcgggtcttccccgcctctgcagcctagtgggaaggaggtgggaggaaagaaggaagaaagggagggagggaggaggcaggccagagggagggaccgcctcggaggcagaagagccgcgaggagccagcggagcaccgcgggctggggcgcagccacccgccgctcctcgagtcccctcgcccctttcccttcgtgccccccggcagcctccagcgtcggtccccaggcagcatggtgaggtctgctcccggaccctcgccaccatgtacgtgagctacctcctggacaaggacgtgagcatgtaccctagctccgtgcgccactctggcggcctcaacctggcgccgcagaacttcgtcagccccccgcagtacccggactacggcggttaccacgtggcggccgcagctgcagcggcagcgaacttggacagcgcgcagtccccggggccatcctggccggcagcgtatggcgccccactccgggaggactggaatggctacgcgcccggaggcgccgcggccgccgccaacgccgtggctcacggcctcaacggtggctccccggccgcagccatgggctacagcagccccgcagactaccatccgcaccaccacccgcatcaccacccgcaccacccggccgccgcgccttcctgcgcttctgggctgctgcaaacgctcaaccccggccctcctgggcccgccgccaccgctgccgccgagcagctgtctcccggcggccagcggcggaacctgtgcgagtggatgcggaagccggcgcagcagtccctcggcagccaagtgaaaaccaggacgaaagacaaatatcgagtggtgtacacggaccaccagcggctggagctggagaaggagtttcactacagtcgctacatcaccatccggaggaaagccgagctagccgccacgctggggctctctgagaggcaggttaaaatctggtttcagaaccgcagagcaaaggagaggaaaatcaacaagaagaagttgcagcagcaacagcagcagcagccaccacagccgcctccgccgccaccacagcctccccagcctcagccaggtcctctgagaagtgtcccagagcccttgagtccggtgtcttccctgcaagcctcagtgtctggctctgtccctggggttctggggccaactgggggggtgctaaaccccaccgtcacccagtgacccaccgggttctgcagcggcagagcaattccaggctgagccatgaggagcgtggactctgctagactcctcaggagagacccctcccctcccacccacagccatagacctacagacctggctctcagaggaaaaatgggagccaggagtaagacaagtgggatttggggcctcaagaaatatactctcccagatttttactttttcccatctggctttttctgccactgaggagacagaaagcctccgctgggcttcattccggactggcagaagcattgcctggactgaccacaccaaccaggccttcatcctcctccccagctcttctcttcctagatctgcaggctgcacctctggctagagccgaggggagagagggactcaagggaaaggcaagcttgaggccaagatggctgctgcctgctcatggccctcggaggtccagctgggcctcctgcctccgggcaggcaaggtttacactgcggaagccaaaggcagctaagatagaaagctggactgaccaaagactgcagaacccccaggtggcctgcgtcttttttctcttcccttcccagaccaggaaaggcttggctggtgtatgcacagggtgtggtatgagggggtggttattggactccaggcctgaccagggggcccgaacagggacttgtttagagagcctgtcaccagagcttctctgggctgaatgtatgtcagtgctataaatgccagagccaacctggacttcctgtcattttcacaatcttggggctgatgaagaagggggtggggggagtttgtgttgttgttgctgctgtttgggttgttggtctgtgtaacatccaagccagagtttttaaagccttctggatccatggggggagaagtgatatggtgaagggaagtggggagtatttgaacacagttgaattttttctaaaaagaaaaagagataaatgagctttccagatttcagattctgtatttatcttcagattttgtctgcaactattttttattttttaaagaaatgaaatatcttcaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:1045 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA
            GeneID:1045 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:1045 -> Molecular function: GO:0003714 [transcription corepressor activity] evidence: IEA
            GeneID:1045 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IDA
            GeneID:1045 -> Biological process: GO:0001568 [blood vessel development] evidence: IEA
            GeneID:1045 -> Biological process: GO:0001829 [trophectodermal cell differentiation] evidence: IEA
            GeneID:1045 -> Biological process: GO:0006366 [transcription from RNA polymerase II promoter] evidence: TAS
            GeneID:1045 -> Biological process: GO:0008333 [endosome to lysosome transport] evidence: IEA
            GeneID:1045 -> Biological process: GO:0009887 [organ morphogenesis] evidence: TAS
            GeneID:1045 -> Biological process: GO:0009952 [anterior/posterior pattern specification] evidence: IEA
            GeneID:1045 -> Biological process: GO:0035019 [somatic stem cell maintenance] evidence: IEA
            GeneID:1045 -> Biological process: GO:0045197 [establishment or maintenance of epithelial cell apical/basal polarity] evidence: IEA
            GeneID:1045 -> Biological process: GO:0045597 [positive regulation of cell differentiation] evidence: IEA
            GeneID:1045 -> Biological process: GO:0060711 [labyrinthine layer development] evidence: IEA
            GeneID:1045 -> Cellular component: GO:0000794 [condensed nuclear chromosome] evidence: IEA
            GeneID:1045 -> Cellular component: GO:0017053 [transcriptional repressor complex] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.