GGRNA | NM_144781.2

LOCUS       NM_144781               2098 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens programmed cell death 2 (PDCD2), transcript variant 2,
            mRNA.
ACCESSION   NM_144781
VERSION     NM_144781.2  GI:313850992
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2098)
  AUTHORS   Kokorina,N.A., Granier,C.J., Zakharkin,S.O., Davis,S., Rabson,A.B.
            and Sabaawy,H.E.
  TITLE     PDCD2 knockdown inhibits erythroid but not megakaryocytic lineage
            differentiation of human hematopoietic stem/progenitor cells
  JOURNAL   Exp. Hematol. 40 (12), 1028-1042 (2012)
   PUBMED   22922207
  REMARK    GeneRIF: PDCD2 has a novel regulatory role in human hematopoiesis
            and is essential for erythroid development.
REFERENCE   2  (bases 1 to 2098)
  AUTHORS   Baron,B.W., Hyjek,E., Gladstone,B., Thirman,M.J. and Baron,J.M.
  TITLE     PDCD2, a protein whose expression is repressed by BCL6, induces
            apoptosis in human cells by activation of the caspase cascade
  JOURNAL   Blood Cells Mol. Dis. 45 (2), 169-175 (2010)
   PUBMED   20605493
  REMARK    GeneRIF: Transfection of a construct expressing PDCD2 induces
            apoptosis in human cell lines through activation of the caspase
            cascade.
REFERENCE   3  (bases 1 to 2098)
  AUTHORS   Fukae,J., Sato,S., Shiba,K., Sato,K., Mori,H., Sharp,P.A.,
            Mizuno,Y. and Hattori,N.
  TITLE     Programmed cell death-2 isoform1 is ubiquitinated by parkin and
            increased in the substantia nigra of patients with autosomal
            recessive Parkinson's disease
  JOURNAL   FEBS Lett. 583 (3), 521-525 (2009)
   PUBMED   19146857
  REMARK    GeneRIF: parkin interacts with programmed cell death-2 isoform 1
            (PDCD2-1)
REFERENCE   4  (bases 1 to 2098)
  AUTHORS   Baron,B.W., Zeleznik-Le,N., Baron,M.J., Theisler,C., Huo,D.,
            Krasowski,M.D., Thirman,M.J., Baron,R.M. and Baron,J.M.
  TITLE     Repression of the PDCD2 gene by BCL6 and the implications for the
            pathogenesis of human B and T cell lymphomas
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 104 (18), 7449-7454 (2007)
   PUBMED   17468402
  REMARK    GeneRIF: repression of PDCD2 by BCL6 is likely important in the
            pathogenesis of certain human lymphomas
REFERENCE   5  (bases 1 to 2098)
  AUTHORS   Chen,Q., Qian,K. and Yan,C.
  TITLE     Cloning of cDNAs with PDCD2(C) domain and their expressions during
            apoptosis of HEK293T cells
  JOURNAL   Mol. Cell. Biochem. 280 (1-2), 185-191 (2005)
   PUBMED   16311922
  REMARK    GeneRIF: To study the role of PDCD2_C domain in apoptosis, the
            cDNAs of two isoforms of PDCD2 and MGC13096 were cloned. PDCD2
            (NM_002598) was over expressed when endothelial cells treated with
            leukotriene D4 or natural killer cells were activated by IL-2.
REFERENCE   6  (bases 1 to 2098)
  AUTHORS   Chistiakov,D.A., Seryogin,Y.A., Turakulov,R.I., Savost'anov,K.V.,
            Titovich,E.V., Zilberman,L.I., Kuraeva,T.L., Dedov,I.I. and
            Nosikov,V.V.
  TITLE     Evaluation of IDDM8 susceptibility locus in a Russian simplex
            family data set
  JOURNAL   J. Autoimmun. 24 (3), 243-250 (2005)
   PUBMED   15848047
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   7  (bases 1 to 2098)
  AUTHORS   Scarr,R.B. and Sharp,P.A.
  TITLE     PDCD2 is a negative regulator of HCF-1 (C1)
  JOURNAL   Oncogene 21 (34), 5245-5254 (2002)
   PUBMED   12149646
REFERENCE   8  (bases 1 to 2098)
  AUTHORS   Baron,B.W., Anastasi,J., Thirman,M.J., Furukawa,Y., Fears,S.,
            Kim,D.C., Simone,F., Birkenbach,M., Montag,A., Sadhu,A.,
            Zeleznik-Le,N. and McKeithan,T.W.
  TITLE     The human programmed cell death-2 (PDCD2) gene is a target of BCL6
            repression: implications for a role of BCL6 in the down-regulation
            of apoptosis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (5), 2860-2865 (2002)
   PUBMED   11854457
REFERENCE   9  (bases 1 to 2098)
  AUTHORS   Kawakami,T., Furukawa,Y., Sudo,K., Saito,H., Takami,S.,
            Takahashi,E. and Nakamura,Y.
  TITLE     Isolation and mapping of a human gene (PDCD2) that is highly
            homologous to Rp8, a rat gene associated with programmed cell death
  JOURNAL   Cytogenet. Cell Genet. 71 (1), 41-43 (1995)
   PUBMED   7606924
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL031259.1 and AJ420535.1.
            On Dec 10, 2010 this sequence version replaced gi:21735593.
            
            Summary: This gene encodes a nuclear protein expressed in a variety
            of tissues. Expression of this gene has been shown to be repressed
            by B-cell CLL/lymphoma 6 (BCL6), a transcriptional repressor
            required for lymph node germinal center development, suggesting
            that BCL6 regulates apoptosis by its effects on this protein.
            Alternative splicing results in multiple transcript variants and
            pseudogenes have been identified on chromosomes 9 and 12. [provided
            by RefSeq, Dec 2010].
            
            Transcript Variant: This variant (2) differs in the 3' coding
            region and UTR, compared to variant 1. The resulting protein
            (isoform 2) has a shorter and distinct C-terminus, compared to
            isoform 1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ420535.1, BG721244.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025088, ERS025098 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-262               AL031259.1         64250-64511
            263-813             AJ420535.1         9-559
            814-814             AL031259.1         65930-65930
            815-1057            AJ420535.1         561-803
            1058-1058           AL031259.1         66174-66174
            1059-1420           AJ420535.1         805-1166
            1421-1421           AL031259.1         66537-66537
            1422-2098           AJ420535.1         1168-1844
FEATURES             Location/Qualifiers
     source          1..2098
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6q27"
     gene            1..2098
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /note="programmed cell death 2"
                     /db_xref="GeneID:5134"
                     /db_xref="HGNC:8762"
                     /db_xref="HPRD:02922"
                     /db_xref="MIM:600866"
     exon            1..394
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /inference="alignment:Splign:1.39.8"
     CDS             112..798
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /note="isoform 2 is encoded by transcript variant 2; zinc
                     finger protein Rp-8; programmed cell death protein 2; zinc
                     finger MYND domain-containing protein 7"
                     /codon_start=1
                     /product="programmed cell death protein 2 isoform 2"
                     /protein_id="NP_659005.1"
                     /db_xref="GI:21735594"
                     /db_xref="CCDS:CCDS47521.1"
                     /db_xref="GeneID:5134"
                     /db_xref="HGNC:8762"
                     /db_xref="HPRD:02922"
                     /db_xref="MIM:600866"
                     /translation="

MAAAGARPVELGFAESAPAWRLRSEQFPSKVGGRPAWLGAAGLPGPQALACELCGRPLSFLLQVYAPLPGRPDAFHRCIFLFCCREQPCCAGLRVFRNQLPRKNDFYSYEPPSENPPPETGESVCLQLKSGAHLCRVCGCLGPKTCSRCHKAYYCSKEHQTLDWRLGHKQACAQPDHLDHIIPDHNFLFPEFEIVIETEDEIMPEVVEKEDYSEIIGSMGKQFQDFIH

"
     misc_feature    514..627
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /note="MYND finger; Region: zf-MYND; pfam01753"
                     /db_xref="CDD:201954"
     variation       372
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11557807"
     STS             386..560
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /standard_name="RH40415"
                     /db_xref="UniSTS:89054"
     exon            395..637
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /inference="alignment:Splign:1.39.8"
     STS             529..630
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /standard_name="SHGC-31353"
                     /db_xref="UniSTS:75965"
     exon            638..2079
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /inference="alignment:Splign:1.39.8"
     variation       1058
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2072917"
     variation       1421
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2066954"
     STS             1764..1988
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /standard_name="RH39860"
                     /db_xref="UniSTS:91330"
     STS             1824..2044
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /standard_name="SHGC-132283"
                     /db_xref="UniSTS:170760"
     STS             1824..1976
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /standard_name="SHGC-183"
                     /db_xref="UniSTS:70157"
     STS             1909..2042
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
                     /standard_name="RH46730"
                     /db_xref="UniSTS:8505"
     polyA_signal    2061..2066
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
     polyA_site      2079
                     /gene="PDCD2"
                     /gene_synonym="RP8; ZMYND7"
ORIGIN

tccgcctcctgtcctccggaaaggtgcccgcctcttgccttccggcccggcgcccgatttccgccttccgacccagctgtgggctgcgccccacgccagcccgcgccccgcatggctgccgccggggccaggcctgtggagctgggcttcgccgagtcggcgccggcgtggcgactgcgcagcgagcagttccccagcaaggtgggcgggcggccggcatggctgggcgcggccgggctgccggggccccaggccctggcctgcgagctgtgcggccgcccgctctccttcctgctgcaggtgtatgcgccgctgcctggccgcccggacgccttccaccgctgcatcttcctcttctgctgccgcgagcagccgtgctgtgccggcctgcgagtttttaggaatcaactacccaggaaaaacgatttttactcatatgagccaccttctgagaatcctcccccagaaacaggagaatcagtgtgtctccagcttaagtctggtgctcatctctgcagggtttgtggctgtttaggccccaaaacgtgctccagatgccacaaagcatattactgcagcaaggagcatcagaccctagactggagattgggacataagcaggcttgtgcacaaccagatcatctggaccatataattccagaccacaacttcctttttccagaatttgaaattgtaatagaaacagaagatgagattatgcctgaggttgtggaaaaggaagattactcagagattatagggagcatgggtaagcagtttcaggacttcattcattaagtggttaaacataatacttggaagaaagggctccatgtgcctagaagagaggtactgagaggaagactcactttggaggctgtagcatacaattttcagatattgcctcaggtaaaaatatacttcctggactttgttttctgacacataagaggtgtgttctgctccctgtaaagacaagggtgggtatccagatggtcccatgagtagggctgcacaagatgctggaggcttggtaagttcctctgggtcgcagatcggtttctcgggtcgggatagtgtgagtgcctagcacagtgtcgggcacgcagaagggccccttaaaagtttctctttcatctggccagttttagatacacaattttgtcagtttacttacagtgcatactcttgggtagtacttgtgctgaccaagtatcttagaggcttattttattatagtagccaacatttatccagcacttaccttatataaagggctgtttgtgcatgagctcattaaaatcgtgacagcagaccaatgagtgagaaactgccccattttgaaggtgaggaaattgaggttctgggtataactttctttggtcacataatattaaattttacaatttgagccttgagccatacacaaaaccaccacaaaattagatttatagactcaaaatgaaaacatcagcttactggtttgtagttcataccagtcatacattccaaaacatgttttgagtcttactctgtgcctgaccttgtgcttgataacagggatataatgggaagcaacactccagtggtcagatgctcacagtcttatggaggagcccaaataatatctggggaagttaaagtccatataatgactgataagagtacaatacaggtgccatgggaacacgtgacatcactgaagactgcctggaaggggccgcgcgtgtgttcatgcctatacgataaacatgatacataatgaaaatgcttatctttaggagaaaggagagcctagagtagcaggatcaaggatgaaagctggacttcaaatatgccttgttagtgtaaatgtgactgtggaactgtatgagtattttaagattatggagtaaagtaagttttaaaaagcagtccctaatcatcaaaagtaaaaaactcttgatgtagtcatataaccacactaagaactcttccaggtgacttcaaaacataggacagtacatctctagtagaatatgccctgagaatgaaaagaatgtaacagtgttagtattttgaataaacatgttattactaaaaaaaaaaaaaaaaaaaa

//

Annotations: