GGRNA Home | Help | Advanced search

2025-11-02 18:44:39, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_003031               2003 bp    mRNA    linear   PRI 16-JUN-2013
DEFINITION  Homo sapiens siah E3 ubiquitin protein ligase 1 (SIAH1), transcript
            variant 1, mRNA.
ACCESSION   NM_003031 NM_001006611
VERSION     NM_003031.3  GI:63148617
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2003)
  AUTHORS   Kitagawa,N., Kondo,S., Wakisaka,N., Zen,Y., Nakanishi,Y., Tsuji,A.,
            Endo,K., Murono,S. and Yoshizaki,T.
  TITLE     Expression of seven-in-absentia homologue 1 and hypoxia-inducible
            factor 1 alpha: novel prognostic factors of nasopharyngeal
            carcinoma
  JOURNAL   Cancer Lett. 331 (1), 52-57 (2013)
   PUBMED   23228635
  REMARK    GeneRIF: High expression of seven-in-absentia homologue 1 is
            associated with nasopharyngeal carcinoma.
REFERENCE   2  (bases 1 to 2003)
  AUTHORS   Velasco,K., Zhao,B., Callegari,S., Altun,M., Liu,H., Hassink,G.,
            Masucci,M.G. and Lindsten,K.
  TITLE     An N-terminal SIAH-interacting motif regulates the stability of the
            ubiquitin specific protease (USP)-19
  JOURNAL   Biochem. Biophys. Res. Commun. 433 (4), 390-395 (2013)
   PUBMED   23500468
  REMARK    GeneRIF: USP19 interacts with the ubiquitin ligases SIAH1 and
            SIAH2, which promote USP19 ubiquitylation and degradation by the
            proteasome.
REFERENCE   3  (bases 1 to 2003)
  AUTHORS   Ko,S.J., Isozaki,K., Kim,I., Lee,J.H., Cho,H.J., Sohn,S.Y.,
            Oh,S.R., Park,S., Kim,D.G., Kim,C.H. and Roche,K.W.
  TITLE     PKC phosphorylation regulates mGluR5 trafficking by enhancing
            binding of Siah-1A
  JOURNAL   J. Neurosci. 32 (46), 16391-16401 (2012)
   PUBMED   23152621
  REMARK    GeneRIF: Calmodulin-regulated Siah-1A binding to mGluR5 dynamically
            regulates mGluR5 trafficking
REFERENCE   4  (bases 1 to 2003)
  AUTHORS   Liu,M., Hsu,J., Chan,C., Li,Z. and Zhou,Q.
  TITLE     The ubiquitin ligase Siah1 controls ELL2 stability and formation of
            super elongation complexes to modulate gene transcription
  JOURNAL   Mol. Cell 46 (3), 325-334 (2012)
   PUBMED   22483617
  REMARK    GeneRIF: Siah1 is the E3 ubiquitin ligase for ELL2
            polyubiquitination and proteasomal degradation.
REFERENCE   5  (bases 1 to 2003)
  AUTHORS   Pietschmann,K., Buchwald,M., Muller,S., Knauer,S.K., Kogl,M.,
            Heinzel,T. and Kramer,O.H.
  TITLE     Differential regulation of PML-RARalpha stability by the ubiquitin
            ligases SIAH1/SIAH2 and TRIAD1
  JOURNAL   Int. J. Biochem. Cell Biol. 44 (1), 132-138 (2012)
   PUBMED   22037423
  REMARK    GeneRIF: In sharp contrast to SIAH1/SIAH2 and UBCH8, TRIAD1 binding
            to PML-RARalpha has no effect on its turnover.
REFERENCE   6  (bases 1 to 2003)
  AUTHORS   Block,K.L., Vornlocher,H.P. and Hershey,J.W.
  TITLE     Characterization of cDNAs encoding the p44 and p35 subunits of
            human translation initiation factor eIF3
  JOURNAL   J. Biol. Chem. 273 (48), 31901-31908 (1998)
   PUBMED   9822659
REFERENCE   7  (bases 1 to 2003)
  AUTHORS   Matsuzawa,S., Takayama,S., Froesch,B.A., Zapata,J.M. and Reed,J.C.
  TITLE     p53-inducible human homologue of Drosophila seven in absentia
            (Siah) inhibits cell growth: suppression by BAG-1
  JOURNAL   EMBO J. 17 (10), 2736-2747 (1998)
   PUBMED   9582267
REFERENCE   8  (bases 1 to 2003)
  AUTHORS   Hu,G., Chung,Y.L., Glover,T., Valentine,V., Look,A.T. and
            Fearon,E.R.
  TITLE     Characterization of human homologs of the Drosophila seven in
            absentia (sina) gene
  JOURNAL   Genomics 46 (1), 103-111 (1997)
   PUBMED   9403064
REFERENCE   9  (bases 1 to 2003)
  AUTHORS   Hu,G., Zhang,S., Vidal,M., Baer,J.L., Xu,T. and Fearon,E.R.
  TITLE     Mammalian homologs of seven in absentia regulate DCC via the
            ubiquitin-proteasome pathway
  JOURNAL   Genes Dev. 11 (20), 2701-2714 (1997)
   PUBMED   9334332
REFERENCE   10 (bases 1 to 2003)
  AUTHORS   Nemani,M., Linares-Cruz,G., Bruzzoni-Giovanelli,H., Roperch,J.P.,
            Tuynder,M., Bougueleret,L., Cherif,D., Medhioub,M., Pasturaud,P.,
            Alvaro,V., der Sarkissan,H., Cazes,L., Le Paslier,D., Le Gall,I.,
            Israeli,D., Dausset,J., Sigaux,F., Chumakov,I., Oren,M., Calvo,F.,
            Amson,R.B., Cohen,D. and Telerman,A.
  TITLE     Activation of the human homologue of the Drosophila sina gene in
            apoptosis and tumor suppression
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 93 (17), 9039-9042 (1996)
   PUBMED   8799150
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC035562.1 and BC018193.1.
            This sequence is a reference standard in the RefSeqGene project.
            On or before May 11, 2005 this sequence version replaced
            gi:55749566, gi:40254443.
            
            Summary: This gene encodes a protein that is a member of the seven
            in absentia homolog (SIAH) family. The protein is an E3 ligase and
            is involved in ubiquitination and proteasome-mediated degradation
            of specific proteins. The activity of this ubiquitin ligase has
            been implicated in the development of certain forms of Parkinson's
            disease, the regulation of the cellular response to hypoxia and
            induction of apoptosis. Alternative splicing results in several
            additional transcript variants, some encoding different isoforms
            and others that have not been fully characterized. [provided by
            RefSeq, Jul 2008].
            
            Transcript Variant: This variant (1) encodes the smaller isoform
            (1).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC035562.1, BC018193.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1492              BC035562.1         1-1492
            1493-2003           BC018193.1         1481-1991
FEATURES             Location/Qualifiers
     source          1..2003
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="16"
                     /map="16q12.1"
     gene            1..2003
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /note="siah E3 ubiquitin protein ligase 1"
                     /db_xref="GeneID:6477"
                     /db_xref="HGNC:10857"
                     /db_xref="MIM:602212"
     exon            1..115
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /inference="alignment:Splign:1.39.8"
     exon            116..2003
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /inference="alignment:Splign:1.39.8"
     CDS             118..966
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /EC_number="6.3.2.-"
                     /note="isoform a is encoded by transcript variant 1; E3
                     ubiquitin-protein ligase SIAH1; seven in absentia homolog
                     1; siah-1a"
                     /codon_start=1
                     /product="E3 ubiquitin-protein ligase SIAH1 isoform a"
                     /protein_id="NP_003022.3"
                     /db_xref="GI:63148618"
                     /db_xref="CCDS:CCDS10735.1"
                     /db_xref="GeneID:6477"
                     /db_xref="HGNC:10857"
                     /db_xref="MIM:602212"
                     /translation="
MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
"
     misc_feature    172..174
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by ATM and ATR; propagated from
                     UniProtKB/Swiss-Prot (Q8IUQ4.2); phosphorylation site"
     misc_feature    232..345
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /note="Zinc finger, C3HC4 type (RING finger); Region:
                     zf-C3HC4_2; pfam13923"
                     /db_xref="CDD:206094"
     misc_feature    361..951
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /note="Seven in absentia protein family; Region: Sina;
                     pfam03145"
                     /db_xref="CDD:190542"
     misc_feature    385..963
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8IUQ4.2);
                     Region: SBD"
     misc_feature    580..960
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /note="Seven in absentia (Sina) protein family, C-terminal
                     substrate binding domain; composed of the Drosophila Sina
                     protein, the mammalian Sina homolog (Siah), the plant
                     protein SINAT5, and similar proteins. Sina, Siah and
                     SINAT5 are RING-containing proteins...; Region: Sina;
                     cd03829"
                     /db_xref="CDD:239753"
     misc_feature    order(601..609,613..615,619..621,646..651)
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239753"
     misc_feature    order(772..774,808..828,832..834,877..882,901..903,
                     913..915)
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239753"
     STS             122..749
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /standard_name="PMC149152P1"
                     /db_xref="UniSTS:271027"
     STS             873..1566
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /standard_name="SIAH1_2345"
                     /db_xref="UniSTS:280995"
     variation       907
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1060155"
     STS             1154..1379
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /standard_name="RH68358"
                     /db_xref="UniSTS:48689"
     variation       1676
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1060181"
     STS             1759..1920
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /standard_name="G20682"
                     /db_xref="UniSTS:20485"
     STS             1759..1920
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /standard_name="RH17142"
                     /db_xref="UniSTS:85949"
     variation       1831
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8190"
     variation       1840
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12883"
     polyA_signal    1986..1991
                     /gene="SIAH1"
                     /gene_synonym="SIAH1A"
ORIGIN      
gtcccgtcggtctcggcgccgggaagaggcggtggcgctgcccgcggtggcgggggttggcgacggagcgcgttggtgccaggaccggggtccgaggcgcgctctccgcccacagaaatgagccgtcagactgctacagcattacctaccggtacctcgaagtgtccaccatcccagagggtgcctgccctgactggcacaactgcatccaacaatgacttggcgagtctttttgagtgtccagtctgctttgactatgtgttaccgcccattcttcaatgtcagagtggccatcttgtttgtagcaactgtcgcccaaagctcacatgttgtccaacttgccggggccctttgggatccattcgcaacttggctatggagaaagtggctaattcagtacttttcccctgtaaatatgcgtcttctggatgtgaaataactctgccacacacagaaaaagcagaccatgaagagctctgtgagtttaggccttattcctgtccgtgccctggtgcttcctgtaaatggcaaggctctctggatgctgtaatgccccatctgatgcatcagcataagtccattacaaccctacagggagaggatatagtttttcttgctacagacattaatcttcctggtgctgttgactgggtgatgatgcagtcctgttttggctttcacttcatgttagtcttagagaaacaggaaaaatacgatggtcaccagcagttcttcgcaatcgtacagctgataggaacacgcaagcaagctgaaaattttgcttaccgacttgagctaaatggtcataggcgacgattgacttgggaagcgactcctcgatctattcatgaaggaattgcaacagccattatgaatagcgactgtctagtctttgacaccagcattgcacagctttttgcagaaaatggcaatttaggcatcaatgtaactatttccatgtgttgaaatggcaatcaaacattttctggccagtgtttaaaacttcagtttcacagaaaataaggcacccatctgtctgccaacctaaaactctttcggtaggtggaagctagacacatgaaggtaaataaaaagaaaggctgttaaatacaggaaacagttgcatgtagtaacactaatatatttaaaaataagtcaacagtaaaccactgaaaaaatatatgtatatacacccaagatgggcatcttttgtattaagaaaggaagcattgtaaaataattctgagttttgtgtttgttgtagattgattgtattgttgaaaaagtttgtttttgcgtgggagtgtgtgcctgcgtgggtgtgtgcgtgtttgggtttttttcctttaactgacaagccatcttgagtggtcatgggccactgcttttccctttgtgagtcaatacatagtgctgctgtgtgctttttttgtgtgtatttgctaatttttattaattttagtttttcattaaataaatttgacttttctgtaattcaggtttttcctttttttgtaccattttaaagttagtatcttttgatatgcatatttgtttatggtaaaaaatttataacgtgttcaatattttcttttcccccattaatcagttcattagaaatattttaaaatcagctattttgtgaagccatgagttccagaaagtaaaggtgacatcggaaaaataatcaaaagctatttaaagcatctataaggtgctctctttctgtcttctacagatgagtcacacctttgagcttaatctttgaaaggttagagaataaattgatttttataaatactgcaaatcaggcttttgtttcctttttcagatatcttggacaaatcacatattttaaaatttgttcttgtatttattggttttgcagaagaaggcatcgtcatgcacagtatttgtaattaaaagcaaatcatttgtttaaaaaggcagtttgcaaaaaatgtttttggtcttttataattctcattaaaagaatatctggc
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:6477 -> Molecular function: GO:0004842 [ubiquitin-protein ligase activity] evidence: IMP
            GeneID:6477 -> Molecular function: GO:0004842 [ubiquitin-protein ligase activity] evidence: ISS
            GeneID:6477 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:6477 -> Molecular function: GO:0008022 [protein C-terminus binding] evidence: IPI
            GeneID:6477 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IDA
            GeneID:6477 -> Molecular function: GO:0008270 [zinc ion binding] evidence: ISS
            GeneID:6477 -> Biological process: GO:0006508 [proteolysis] evidence: TAS
            GeneID:6477 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
            GeneID:6477 -> Biological process: GO:0007049 [cell cycle] evidence: IEA
            GeneID:6477 -> Biological process: GO:0007283 [spermatogenesis] evidence: IEA
            GeneID:6477 -> Biological process: GO:0007399 [nervous system development] evidence: TAS
            GeneID:6477 -> Biological process: GO:0007411 [axon guidance] evidence: TAS
            GeneID:6477 -> Biological process: GO:0009653 [anatomical structure morphogenesis] evidence: TAS
            GeneID:6477 -> Biological process: GO:0030163 [protein catabolic process] evidence: IDA
            GeneID:6477 -> Biological process: GO:0031648 [protein destabilization] evidence: IEA
            GeneID:6477 -> Biological process: GO:0042787 [protein ubiquitination involved in ubiquitin-dependent protein catabolic process] evidence: ISS
            GeneID:6477 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IDA
            GeneID:6477 -> Biological process: GO:0043161 [proteasomal ubiquitin-dependent protein catabolic process] evidence: ISS
            GeneID:6477 -> Biological process: GO:0051402 [neuron apoptotic process] evidence: ISS
            GeneID:6477 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: IMP
            GeneID:6477 -> Cellular component: GO:0005634 [nucleus] evidence: ISS
            GeneID:6477 -> Cellular component: GO:0005737 [cytoplasm] evidence: TAS
            GeneID:6477 -> Cellular component: GO:0005769 [early endosome] evidence: IEA
            GeneID:6477 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
            GeneID:6477 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA
            GeneID:6477 -> Cellular component: GO:0030877 [beta-catenin destruction complex] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_003022 -> EC 6.3.2.-

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.