2025-10-22 22:09:06, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001244569 2006 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens BH3 interacting domain death agonist (BID), transcript variant 5, mRNA. ACCESSION NM_001244569 VERSION NM_001244569.1 GI:347300415 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2006) AUTHORS Moldoveanu,T., Grace,C.R., Llambi,F., Nourse,A., Fitzgerald,P., Gehring,K., Kriwacki,R.W. and Green,D.R. TITLE BID-induced structural changes in BAK promote apoptosis JOURNAL Nat. Struct. Mol. Biol. 20 (5), 589-597 (2013) PUBMED 23604079 REMARK GeneRIF: BAK activation follows a 'hit-and-run' mechanism whereby BID dissociates from the trigger site, which allows BAK oligomerization at an overlapping interface. REFERENCE 2 (bases 1 to 2006) AUTHORS Santiveri,C.M., Sborgi,L. and de Alba,E. TITLE Nuclear magnetic resonance study of protein-protein interactions involving apoptosis regulator Diva (Boo) and the BH3 domain of proapoptotic Bcl-2 members JOURNAL J. Mol. Recognit. 25 (12), 665-673 (2012) PUBMED 23192964 REMARK GeneRIF: Diva binds peptides derived from the BH3 domain of several other proapoptotic Bcl-2 proteins, including mouse Harakiri, Bid, Bak and Bmf. REFERENCE 3 (bases 1 to 2006) AUTHORS Jiang,H., He,P., Adler,C.H., Shill,H., Beach,T.G., Li,R. and Shen,Y. TITLE Bid signal pathway components are identified in the temporal cortex with Parkinson disease JOURNAL Neurology 79 (17), 1767-1773 (2012) PUBMED 23019260 REMARK GeneRIF: Patients with Parkinson disease have an activated Bid-mediated destructive signal pathway via tumor necrosis factor death receptor I (TNFRI) in the temporal cortex. REFERENCE 4 (bases 1 to 2006) AUTHORS Aranovich,A., Liu,Q., Collins,T., Geng,F., Dixit,S., Leber,B. and Andrews,D.W. TITLE Differences in the mechanisms of proapoptotic BH3 proteins binding to Bcl-XL and Bcl-2 quantified in live MCF-7 cells JOURNAL Mol. Cell 45 (6), 754-763 (2012) PUBMED 22464442 REMARK GeneRIF: mechanism of proapoptotic BH3 proteins Bad and Bid binding to Bcl-XL and Bcl-2 in breast cancer cells REFERENCE 5 (bases 1 to 2006) AUTHORS Appelqvist,H., Johansson,A.C., Linderoth,E., Johansson,U., Antonsson,B., Steinfeld,R., Kagedal,K. and Ollinger,K. TITLE Lysosome-mediated apoptosis is associated with cathepsin D-specific processing of bid at Phe24, Trp48, and Phe183 JOURNAL Ann. Clin. Lab. Sci. 42 (3), 231-242 (2012) PUBMED 22964611 REMARK GeneRIF: Three cathepsin D-specific cleavage sites in Bid, Phe24, Trp48, and Phe183, were identified. REFERENCE 6 (bases 1 to 2006) AUTHORS Footz,T.K., Birren,B., Minoshima,S., Asakawa,S., Shimizu,N., Riazi,M.A. and McDermid,H.E. TITLE The gene for death agonist BID maps to the region of human 22q11.2 duplicated in cat eye syndrome chromosomes and to mouse chromosome 6 JOURNAL Genomics 51 (3), 472-475 (1998) PUBMED 9721221 REFERENCE 7 (bases 1 to 2006) AUTHORS Huang,D.C., Adams,J.M. and Cory,S. TITLE The conserved N-terminal BH4 domain of Bcl-2 homologues is essential for inhibition of apoptosis and interaction with CED-4 JOURNAL EMBO J. 17 (4), 1029-1039 (1998) PUBMED 9463381 REFERENCE 8 (bases 1 to 2006) AUTHORS Wang,K., Yin,X.M., Chao,D.T., Milliman,C.L. and Korsmeyer,S.J. TITLE BID: a novel BH3 domain-only death agonist JOURNAL Genes Dev. 10 (22), 2859-2869 (1996) PUBMED 8918887 REFERENCE 9 (bases 1 to 2006) AUTHORS Amagai,M., Wang,Y., Minoshima,S., Kawamura,K., Green,K.J., Nishikawa,T. and Shimizu,N. TITLE Assignment of the human genes for desmocollin 3 (DSC3) and desmocollin 4 (DSC4) to chromosome 18q12 JOURNAL Genomics 25 (1), 330-332 (1995) PUBMED 7774948 REFERENCE 10 (bases 1 to 2006) AUTHORS Kawamura,K., Watanabe,K., Suzuki,T., Yamakawa,T., Kamiyama,T., Nakagawa,H. and Tsurufuji,S. TITLE cDNA cloning and expression of a novel human desmocollin JOURNAL J. Biol. Chem. 269 (42), 26295-26302 (1994) PUBMED 7929347 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA158889.1, CN277529.1, AK094795.1, AC006285.13 and BC036364.1. Summary: This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (5) has an alternate 5' exon and uses a downstream in-frame start codon, as compared to variant 1. The encoded isoform 3 thus has a shorter N-terminus, as compared to isoform 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BU168412.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-35 DA158889.1 1-35 36-506 CN277529.1 6-476 507-610 AK094795.1 977-1080 611-611 AC006285.13 123432-123432 c 612-1966 AK094795.1 1082-2436 1967-1967 AC006285.13 122076-122076 c 1968-1988 AK094795.1 2438-2458 1989-2006 BC036364.1 2495-2512 FEATURES Location/Qualifiers source 1..2006 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="22" /map="22q11.1" gene 1..2006 /gene="BID" /gene_synonym="FP497" /note="BH3 interacting domain death agonist" /db_xref="GeneID:637" /db_xref="HGNC:1050" /db_xref="MIM:601997" exon 1..115 /gene="BID" /gene_synonym="FP497" /inference="alignment:Splign:1.39.8" exon 116..185 /gene="BID" /gene_synonym="FP497" /inference="alignment:Splign:1.39.8" misc_feature 182..184 /gene="BID" /gene_synonym="FP497" /note="upstream in-frame stop codon" exon 186..325 /gene="BID" /gene_synonym="FP497" /inference="alignment:Splign:1.39.8" CDS 251..550 /gene="BID" /gene_synonym="FP497" /note="isoform 3 is encoded by transcript variant 5; BH3-interacting domain death agonist; apoptic death agonist; Human BID coding sequence; desmocollin type 4; BID isoform ES(1b); BID isoform L(2); BID isoform Si6; p22 BID" /codon_start=1 /product="BH3-interacting domain death agonist isoform 3" /protein_id="NP_001231498.1" /db_xref="GI:347300416" /db_xref="CCDS:CCDS13749.1" /db_xref="GeneID:637" /db_xref="HGNC:1050" /db_xref="MIM:601997" /translation="
MDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
" misc_feature <251..538 /gene="BID" /gene_synonym="FP497" /note="BH3 interacting domain (BID); Region: BID; pfam06393" /db_xref="CDD:203434" exon 326..538 /gene="BID" /gene_synonym="FP497" /inference="alignment:Splign:1.39.8" variation 490 /gene="BID" /gene_synonym="FP497" /replace="c" /replace="t" /db_xref="dbSNP:11538" exon 539..1990 /gene="BID" /gene_synonym="FP497" /inference="alignment:Splign:1.39.8" variation 585 /gene="BID" /gene_synonym="FP497" /replace="c" /replace="t" /db_xref="dbSNP:8190354" STS 609..683 /gene="BID" /gene_synonym="FP497" /standard_name="SHGC-36512" /db_xref="UniSTS:4995" variation 701 /gene="BID" /gene_synonym="FP497" /replace="a" /replace="t" /db_xref="dbSNP:1802194" variation 716 /gene="BID" /gene_synonym="FP497" /replace="a" /replace="c" /db_xref="dbSNP:1061200" polyA_site 768 /gene="BID" /gene_synonym="FP497" STS 960..1121 /gene="BID" /gene_synonym="FP497" /standard_name="RH92974" /db_xref="UniSTS:89764" variation 1012 /gene="BID" /gene_synonym="FP497" /replace="a" /replace="g" /db_xref="dbSNP:8190355" variation 1099..1100 /gene="BID" /gene_synonym="FP497" /replace="" /replace="a" /db_xref="dbSNP:201806962" variation 1099 /gene="BID" /gene_synonym="FP497" /replace="" /replace="a" /db_xref="dbSNP:8190357" variation 1508 /gene="BID" /gene_synonym="FP497" /replace="a" /replace="t" /db_xref="dbSNP:8190358" variation 1814..1817 /gene="BID" /gene_synonym="FP497" /replace="" /replace="cttt" /db_xref="dbSNP:78336589" variation 1816..1817 /gene="BID" /gene_synonym="FP497" /replace="" /replace="cttt" /db_xref="dbSNP:201965650" variation 1817 /gene="BID" /gene_synonym="FP497" /replace="" /replace="cttt" /db_xref="dbSNP:8190359" variation 1820 /gene="BID" /gene_synonym="FP497" /replace="" /replace="aa" /db_xref="dbSNP:25591" variation 1944 /gene="BID" /gene_synonym="FP497" /replace="a" /replace="g" /db_xref="dbSNP:8190360" variation 1945 /gene="BID" /gene_synonym="FP497" /replace="c" /replace="t" /db_xref="dbSNP:8190361" variation 1951 /gene="BID" /gene_synonym="FP497" /replace="a" /replace="g" /db_xref="dbSNP:8190362" polyA_signal 1970..1975 /gene="BID" /gene_synonym="FP497" polyA_site 1990 /gene="BID" /gene_synonym="FP497" ORIGIN
gaaggaggaagcgcgcggggcgccataaggaggaagcgggtagtcgaccgtgtccgcgcgcctgggagacgctgcctcggcccggacgcgcccgcgcccccgcggctggagggtggtcgccactgggacactgtgaaccaggagtgagtcggagctgccgcgctgcccaggccatggactgtgagattctgaaagtcaagaagacatcatccggaatattgccaggcacctcgcccaggtcggggacagcatggaccgtagcatccctccgggcctggtgaacggcctggccctgcagctcaggaacaccagccggtcggaggaggaccggaacagggacctggccactgccctggagcagctgctgcaggcctaccctagagacatggagaaggagaagaccatgctggtgctggccctgctgctggccaagaaggtggccagtcacacgccgtccttgctccgtgatgtctttcacacaacagtgaattttattaaccagaacctacgcacctacgtgaggagcttagccagaaatgggatggactgaacggacagttccagaagtgtgactggctaaagctcgatgtggtcacagctgtatagctgcttccagtgtagacggagccctggcatgtcaacagcgttcctagagaagacaggctggaagatagctgtgacttctattttaaagacaatgttaaacttataacccactttaaaatatctacattaatatacttgaatgaaaatgtccatttacacgtatttgaatggccttcatatcatccacacatgaatctgcacatctgtaaatctacacacggtgcctttatttccactgtgcaggttcccacttaaaaattaaattggaaagcaggtttcaaggaagtagaaacaaaatacaatttttttggtaaaaaaaaattactgtttattaaagtacaaccatagaggatggtcttacagcaggcagtatcctgtttgaggaaagcaagaatcagagaaggaacataccccttacaaatgaaaaattccactcaaaatagggactatctatcttaatactaaggaaccaacaatcttcctgtttaaaaaaccacatggcacagagattctgaactaaagtgctgcactcaaatgatgggaagtccggccccagtacacaggggcttgactttttcaacttcgtttcctttgttggagtcaaaaagaaccacttgtggttctaaaaggtgtgaaggtgatttaagggcccaggtcagccactgtttgtttacaaaatcaggtaactaactgcatacactttttctctttccatgacatcaagactttgctaaagacatgaagccacgggtgccagaagctactgcgatgccccgggagttagccccctggtaatagctgtaaacttccaatttctagccatacgctcagctcatccatgcctcagaagtgcatctggagagaacaggtttctaagcataaaagatgaaagagcagttggactttttaaaaattcagcaaagtggttccctctcttagggacagtcaaaaccaagtcacttaggtagtaccaaaataaataaggaaaagcttagctttagaaacagtgcaacactggtctgctgttccagtggtaagctatgtcccaggaatcagtttaaaagcacgacagtggatgctgggtccatatcacacacattgctgtgaacaggaaactcctgtgaccacaacatgaggccactggagacgcatatgagtaagggcactgacggactcatgatttcttcttaccagatgctttcctgttctttaagagtttaaaatcatcagaaaggaaaaacaaactctatattgttcagcatgcaatacataccacgctagggctggctcaattgaaagtgggcaaaagcttacaaatactaaaaagaagtgctgccgcgcagtgtggaggccactgtttggaaataaatcttcctaacactacaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:637 -> Molecular function: GO:0005123 [death receptor binding] evidence: TAS GeneID:637 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:637 -> Molecular function: GO:0031625 [ubiquitin protein ligase binding] evidence: IEA GeneID:637 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: IDA GeneID:637 -> Biological process: GO:0006626 [protein targeting to mitochondrion] evidence: IEA GeneID:637 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:637 -> Biological process: GO:0007420 [brain development] evidence: IEA GeneID:637 -> Biological process: GO:0008625 [extrinsic apoptotic signaling pathway via death domain receptors] evidence: TAS GeneID:637 -> Biological process: GO:0008637 [apoptotic mitochondrial changes] evidence: TAS GeneID:637 -> Biological process: GO:0032355 [response to estradiol stimulus] evidence: IEA GeneID:637 -> Biological process: GO:0032461 [positive regulation of protein oligomerization] evidence: IDA GeneID:637 -> Biological process: GO:0032464 [positive regulation of protein homooligomerization] evidence: IDA GeneID:637 -> Biological process: GO:0034349 [glial cell apoptotic process] evidence: IEA GeneID:637 -> Biological process: GO:0042127 [regulation of cell proliferation] evidence: IEA GeneID:637 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IMP GeneID:637 -> Biological process: GO:0046902 [regulation of mitochondrial membrane permeability] evidence: IEA GeneID:637 -> Biological process: GO:0051260 [protein homooligomerization] evidence: IEA GeneID:637 -> Biological process: GO:0051402 [neuron apoptotic process] evidence: TAS GeneID:637 -> Biological process: GO:0090150 [establishment of protein localization to membrane] evidence: IDA GeneID:637 -> Biological process: GO:0090200 [positive regulation of release of cytochrome c from mitochondria] evidence: IGI GeneID:637 -> Biological process: GO:0090200 [positive regulation of release of cytochrome c from mitochondria] evidence: IMP GeneID:637 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS GeneID:637 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS GeneID:637 -> Biological process: GO:1901030 [positive regulation of mitochondrial outer membrane permeabilization] evidence: TAS GeneID:637 -> Biological process: GO:2000045 [regulation of G1/S transition of mitotic cell cycle] evidence: IEA GeneID:637 -> Biological process: GO:2001238 [positive regulation of extrinsic apoptotic signaling pathway] evidence: IMP GeneID:637 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: TAS GeneID:637 -> Cellular component: GO:0005739 [mitochondrion] evidence: TAS GeneID:637 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: TAS GeneID:637 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:637 -> Cellular component: GO:0016020 [membrane] evidence: TAS GeneID:637 -> Cellular component: GO:0032592 [integral to mitochondrial membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.