2025-09-18 19:38:43, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001198557 2267 bp mRNA linear PRI 12-MAY-2013 DEFINITION Homo sapiens lamin B1 (LMNB1), transcript variant 2, mRNA. ACCESSION NM_001198557 VERSION NM_001198557.1 GI:310689048 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2267) AUTHORS Dreesen,O., Chojnowski,A., Ong,P.F., Zhao,T.Y., Common,J.E., Lunny,D., Lane,E.B., Lee,S.J., Vardy,L.A., Stewart,C.L. and Colman,A. TITLE Lamin B1 fluctuations have differential effects on cellular proliferation and senescence JOURNAL J. Cell Biol. 200 (5), 605-617 (2013) PUBMED 23439683 REMARK GeneRIF: LMNB1 protein levels decline in senescent human dermal fibroblasts and keratinocytes, mediated by reduced transcription and inhibition of LMNB1 messenger ribonucleic acid translation by miRNA-23a. REFERENCE 2 (bases 1 to 2267) AUTHORS Columbaro,M., Mattioli,E., Maraldi,N.M., Ortolani,M., Gasparini,L., D'Apice,M.R., Postorivo,D., Nardone,A.M., Avnet,S., Cortelli,P., Liguori,R. and Lattanzi,G. TITLE Oct-1 recruitment to the nuclear envelope in adult-onset autosomal dominant leukodystrophy JOURNAL Biochim. Biophys. Acta 1832 (3), 411-420 (2013) PUBMED 23261988 REMARK GeneRIF: Results indicate that lamin B1 (LMNB1) accumulation in adult-onset autosomal dominant leukodystrophy (ADLD) is associated with Oct-1 recruitment. REFERENCE 3 (bases 1 to 2267) AUTHORS Brussino,A., Vaula,G., Cagnoli,C., Mauro,A., Pradotto,L., Daniele,D., Di Gregorio,E., Barberis,M., Arduino,C., Squadrone,S., Abete,M.C., Migone,N., Calabrese,O. and Brusco,A. TITLE A novel family with Lamin B1 duplication associated with adult-onset leucoencephalopathy JOURNAL J. Neurol. Neurosurg. Psychiatr. 80 (2), 237-240 (2009) PUBMED 19151023 REMARK GeneRIF: duplication of the lamin B1 gene (LMNB1) has recently been described in a rare form of autosomal dominant adult-onset leukoencephalopathy. REFERENCE 4 (bases 1 to 2267) AUTHORS Shimi,T., Pfleghaar,K., Kojima,S., Pack,C.G., Solovei,I., Goldman,A.E., Adam,S.A., Shumaker,D.K., Kinjo,M., Cremer,T. and Goldman,R.D. TITLE The A- and B-type nuclear lamin networks: microdomains involved in chromatin organization and transcription JOURNAL Genes Dev. 22 (24), 3409-3421 (2008) PUBMED 19141474 REMARK GeneRIF: Silencing lamin B1 expression dramatically increases the lamina meshwork size and the mobility of nucleoplasmic lamin A REFERENCE 5 (bases 1 to 2267) AUTHORS Gruenbaum,Y., Wilson,K.L., Harel,A., Goldberg,M. and Cohen,M. TITLE Review: nuclear lamins--structural proteins with fundamental functions JOURNAL J. Struct. Biol. 129 (2-3), 313-323 (2000) PUBMED 10806082 REMARK Review article REFERENCE 6 (bases 1 to 2267) AUTHORS Broers,J.L., Machiels,B.M., Kuijpers,H.J., Smedts,F., van den Kieboom,R., Raymond,Y. and Ramaekers,F.C. TITLE A- and B-type lamins are differentially expressed in normal human tissues JOURNAL Histochem. Cell Biol. 107 (6), 505-517 (1997) PUBMED 9243284 REFERENCE 7 (bases 1 to 2267) AUTHORS Wydner,K.L., McNeil,J.A., Lin,F., Worman,H.J. and Lawrence,J.B. TITLE Chromosomal assignment of human nuclear envelope protein genes LMNA, LMNB1, and LBR by fluorescence in situ hybridization JOURNAL Genomics 32 (3), 474-478 (1996) PUBMED 8838815 REFERENCE 8 (bases 1 to 2267) AUTHORS Lin,F. and Worman,H.J. TITLE Structural organization of the human gene (LMNB1) encoding nuclear lamin B1 JOURNAL Genomics 27 (2), 230-236 (1995) PUBMED 7557986 REFERENCE 9 (bases 1 to 2267) AUTHORS Foisner,R., Traub,P. and Wiche,G. TITLE Protein kinase A- and protein kinase C-regulated interaction of plectin with lamin B and vimentin JOURNAL Proc. Natl. Acad. Sci. U.S.A. 88 (9), 3812-3816 (1991) PUBMED 2023931 REFERENCE 10 (bases 1 to 2267) AUTHORS Djabali,K., Portier,M.M., Gros,F., Blobel,G. and Georgatos,S.D. TITLE Network antibodies identify nuclear lamin B as a physiological attachment site for peripherin intermediate filaments JOURNAL Cell 64 (1), 109-121 (1991) PUBMED 1986862 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK303084.1, AC137794.2 and AW512433.1. Summary: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. This gene encodes one of the two B type proteins, B1. Alternative splicing results in transcript variants and a duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). [provided by RefSeq, Oct 2010]. Transcript Variant: This variant (2) differs in the 5' UTR, lacks a portion of the 5' coding region, and initiates translation at an downstream start codon, compared to variant 1. The resulting protein (isoform 2) is shorter than isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK303084.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-426 AK303084.1 1-426 427-427 AC137794.2 59029-59029 c 428-1536 AK303084.1 428-1536 1537-2209 AC137794.2 32281-32953 c 2210-2267 AW512433.1 1-58 c FEATURES Location/Qualifiers source 1..2267 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="5" /map="5q23.2" gene 1..2267 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /note="lamin B1" /db_xref="GeneID:4001" /db_xref="HGNC:6637" /db_xref="MIM:150340" exon 1..92 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /inference="alignment:Splign:1.39.8" exon 93..249 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /inference="alignment:Splign:1.39.8" variation complement(147) /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /replace="c" /replace="t" /db_xref="dbSNP:3749830" exon 250..375 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /inference="alignment:Splign:1.39.8" CDS 364..1494 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /note="isoform 2 is encoded by transcript variant 2" /codon_start=1 /product="lamin-B1 isoform 2" /protein_id="NP_001185486.1" /db_xref="GI:310689049" /db_xref="GeneID:4001" /db_xref="HGNC:6637" /db_xref="MIM:150340" /translation="
MYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSEMNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
" misc_feature <364..864 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /note="Intermediate filament protein; Region: Filament; pfam00038" /db_xref="CDD:200948" misc_feature 1048..1362 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /note="Lamin Tail Domain; Region: LTD; pfam00932" /db_xref="CDD:201513" exon 376..546 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /inference="alignment:Splign:1.39.8" exon 547..672 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /inference="alignment:Splign:1.39.8" exon 673..893 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /inference="alignment:Splign:1.39.8" exon 894..1119 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /inference="alignment:Splign:1.39.8" exon 1120..1224 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /inference="alignment:Splign:1.39.8" exon 1225..1344 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /inference="alignment:Splign:1.39.8" variation complement(1235) /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /replace="c" /replace="t" /db_xref="dbSNP:36105360" exon 1345..1452 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /inference="alignment:Splign:1.39.8" exon 1453..2250 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" /inference="alignment:Splign:1.39.8" polyA_signal 2226..2231 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" polyA_site 2244 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" polyA_site 2250 /gene="LMNB1" /gene_synonym="ADLD; LMN; LMN2; LMNB" ORIGIN
aggaaacaaagtgctgcgagcaggagacggcggcggcgcgaaccctgctgggcctccagtcaccctcgtcttgcattttcccgcgtgcgtgtctatgctaagaaggaatctgatcttaatggcgcccagatcaagcttcgagaatatgaagcagcactgaattcgaaagatgcagctcttgctactgcacttggtgacaaaaaaagtttagagggagatttggaggatctgaaggatcagattgcccagttggaagcctccttagctgcagccaaaaaacagttagcagatgaaactttacttaaagtagatttggagaatcgttgtcagagccttactgaggacttggagtttcgcaaaagcatgtatgaagaggagattaacgagaccagaaggaagcatgaaacgcgcttggtagaggtggattctgggcgtcaaattgagtatgagtacaagctggcgcaagcccttcatgagatgagagagcaacatgatgcccaagtgaggctgtataaggaggagctggagcagacttaccatgccaaacttgagaatgccagactgtcatcagagatgaatacttctactgtcaacagtgccagggaagaactgatggaaagccgcatgagaattgagagcctttcatcccagctttctaatctacagaaagagtctagagcatgtttggaaaggattcaagaattagaggacttgcttgctaaagaaaaagacaactctcgtcgcatgctgacagacaaagagagagagatggcggaaataagggatcaaatgcagcaacagctgaatgactatgaacagcttcttgatgtaaagttagccctggacatggaaatcagtgcttacaggaaactcttagaaggcgaagaagagaggttgaagctgtctccaagcccttcttcccgtgtgacagtatcccgagcatcctcaagtcgtagtgtacgtacaactagaggaaagcggaagagggttgatgtggaagaatcagaggcgagtagtagtgttagcatctctcattccgcctcagccactggaaatgtttgcatcgaagaaattgatgttgatgggaaatttatccgcttgaagaacacttctgaacaggatcaaccaatgggaggctgggagatgatcagaaaaattggagacacatcagtcagttataaatatacctcaagatatgtgctgaaggcaggccagactgttacaatttgggctgcaaacgctggtgtcacagccagccccccaactgacctcatctggaagaaccagaactcgtggggcactggcgaagatgtgaaggttatattgaaaaattctcagggagaggaggttgctcaaagaagtacagtctttaaaacaaccatacctgaagaagaggaggaggaggaagaagcagctggagtggttgttgaggaagaacttttccaccagcagggaaccccaagagcatccaatagaagctgtgcaattatgtaaaattttcaactgtcttcctcaaaataaagaagtatggtaatctttacctgtatacagtgcagagccttctcagaagcacagaatatttttatatttcctttatgtgaatttttaagctgcaaatctgatggccttaatttcctttttgacactgaaagttttgtaaaagaaatcatgtccatacactttgttgcaagatgtgaattattgacactgaacttaataactgtgtactgttcggaaggggttcctcaaattttttgactttttttgtatgtgtgttttttctttttttttaagttcttatgaggaggggagggtaaataaaccactgtgcgtcttggtgtaatttgaagattgccccatctagactagcaatctcttcattattctctgctatatataaaacggtgctgtgagggaggggaaaagcatttttcaatatattgaacttttgtactgaatttttttgtaataagcaatcaaggttataattttttttaaaatagaaattttgtaagaaggcaatattaacctaatcaccatgtaagcactctggatgatggattccacaaaacttggttttatggttacttcttctcttagattcttaattcatgaggagggtgggggagggaggtggagggagggaagggtttctctattaaaatgcattcgttgtgttttttaagatagtgtaacttgcttaaatttcttatgtgacattaacaaataaaaaagctcttttaatattgaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:4001 -> Molecular function: GO:0005198 [structural molecule activity] evidence: IEA GeneID:4001 -> Molecular function: GO:0043274 [phospholipase binding] evidence: IEA GeneID:4001 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:4001 -> Biological process: GO:0006921 [cellular component disassembly involved in execution phase of apoptosis] evidence: TAS GeneID:4001 -> Cellular component: GO:0005635 [nuclear envelope] evidence: TAS GeneID:4001 -> Cellular component: GO:0005637 [nuclear inner membrane] evidence: IEA GeneID:4001 -> Cellular component: GO:0005638 [lamin filament] evidence: IEA GeneID:4001 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.