2025-09-18 19:20:35, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001185158 1621 bp mRNA linear PRI 15-JUN-2013 DEFINITION Homo sapiens interleukin 24 (IL24), transcript variant 5, mRNA. ACCESSION NM_001185158 VERSION NM_001185158.1 GI:297632405 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1621) AUTHORS Tian,H., Li,L., Zhang,B., Di,J., Chen,F., Li,H., Liu,J., Pei,D. and Zheng,J. TITLE Critical role of lysine 123 in the ubiquitin-mediated degradation of MDA-7/IL-24 JOURNAL J. Interferon Cytokine Res. 32 (12), 575-582 (2012) PUBMED 23078624 REMARK GeneRIF: Data suggest that IL24 is ubiquitinated and degraded by 26S proteasomes; data from site-directed mutagenesis study suggest that lysine 123 is the major internal lysine involved in ubiquitination of IL24; K123R mutant promotes apoptosis of HeLa cells. REFERENCE 2 (bases 1 to 1621) AUTHORS Jostins,L., Ripke,S., Weersma,R.K., Duerr,R.H., McGovern,D.P., Hui,K.Y., Lee,J.C., Schumm,L.P., Sharma,Y., Anderson,C.A., Essers,J., Mitrovic,M., Ning,K., Cleynen,I., Theatre,E., Spain,S.L., Raychaudhuri,S., Goyette,P., Wei,Z., Abraham,C., Achkar,J.P., Ahmad,T., Amininejad,L., Ananthakrishnan,A.N., Andersen,V., Andrews,J.M., Baidoo,L., Balschun,T., Bampton,P.A., Bitton,A., Boucher,G., Brand,S., Buning,C., Cohain,A., Cichon,S., D'Amato,M., De Jong,D., Devaney,K.L., Dubinsky,M., Edwards,C., Ellinghaus,D., Ferguson,L.R., Franchimont,D., Fransen,K., Gearry,R., Georges,M., Gieger,C., Glas,J., Haritunians,T., Hart,A., Hawkey,C., Hedl,M., Hu,X., Karlsen,T.H., Kupcinskas,L., Kugathasan,S., Latiano,A., Laukens,D., Lawrance,I.C., Lees,C.W., Louis,E., Mahy,G., Mansfield,J., Morgan,A.R., Mowat,C., Newman,W., Palmieri,O., Ponsioen,C.Y., Potocnik,U., Prescott,N.J., Regueiro,M., Rotter,J.I., Russell,R.K., Sanderson,J.D., Sans,M., Satsangi,J., Schreiber,S., Simms,L.A., Sventoraityte,J., Targan,S.R., Taylor,K.D., Tremelling,M., Verspaget,H.W., De Vos,M., Wijmenga,C., Wilson,D.C., Winkelmann,J., Xavier,R.J., Zeissig,S., Zhang,B., Zhang,C.K., Zhao,H., Silverberg,M.S., Annese,V., Hakonarson,H., Brant,S.R., Radford-Smith,G., Mathew,C.G., Rioux,J.D., Schadt,E.E., Daly,M.J., Franke,A., Parkes,M., Vermeire,S., Barrett,J.C. and Cho,J.H. CONSRTM International IBD Genetics Consortium (IIBDGC) TITLE Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease JOURNAL Nature 491 (7422), 119-124 (2012) PUBMED 23128233 REFERENCE 3 (bases 1 to 1621) AUTHORS Bosanquet,D.C., Harding,K.G., Ruge,F., Sanders,A.J. and Jiang,W.G. TITLE Expression of IL-24 and IL-24 receptors in human wound tissues and the biological implications of IL-24 on keratinocytes JOURNAL Wound Repair Regen 20 (6), 896-903 (2012) PUBMED 23110359 REMARK GeneRIF: IL-24 appears to promote wound chronicity via its inhibitory effect on the migratory behavior of human keratinocytes, mediated through an AKT-dependent pathway. REFERENCE 4 (bases 1 to 1621) AUTHORS Allen,M., Pratscher,B., Krepler,C., Frei,K., Schofer,C., Pehamberger,H., Muller,M. and Lucas,T. TITLE Alternative splicing of IL-24 in melanocytes by deletion of exons 3 and 5 JOURNAL Int. J. Immunogenet. 32 (6), 375-378 (2005) PUBMED 16313301 REFERENCE 5 (bases 1 to 1621) AUTHORS Zhang,Z. and Henzel,W.J. TITLE Signal peptide prediction based on analysis of experimentally verified cleavage sites JOURNAL Protein Sci. 13 (10), 2819-2824 (2004) PUBMED 15340161 REFERENCE 6 (bases 1 to 1621) AUTHORS Allen,M., Pratscher,B., Roka,F., Krepler,C., Wacheck,V., Schofer,C., Pehamberger,H., Muller,M. and Lucas,T. TITLE Loss of novel mda-7 splice variant (mda-7s) expression is associated with metastatic melanoma JOURNAL J. Invest. Dermatol. 123 (3), 583-588 (2004) PUBMED 15304100 REMARK GeneRIF: mda-7s expression is linked to a non-metastatic phenotype REFERENCE 7 (bases 1 to 1621) AUTHORS Huang,E.Y., Madireddi,M.T., Gopalkrishnan,R.V., Leszczyniecka,M., Su,Z., Lebedeva,I.V., Kang,D., Jiang,H., Lin,J.J., Alexandre,D., Chen,Y., Vozhilla,N., Mei,M.X., Christiansen,K.A., Sivo,F., Goldstein,N.I., Mhashilkar,A.B., Chada,S., Huberman,E., Pestka,S. and Fisher,P.B. TITLE Genomic structure, chromosomal localization and expression profile of a novel melanoma differentiation associated (mda-7) gene with cancer specific growth suppressing and apoptosis inducing properties JOURNAL Oncogene 20 (48), 7051-7063 (2001) PUBMED 11704829 REFERENCE 8 (bases 1 to 1621) AUTHORS Su,Z.Z., Madireddi,M.T., Lin,J.J., Young,C.S., Kitada,S., Reed,J.C., Goldstein,N.I. and Fisher,P.B. TITLE The cancer growth suppressor gene mda-7 selectively induces apoptosis in human breast cancer cells and inhibits tumor growth in nude mice JOURNAL Proc. Natl. Acad. Sci. U.S.A. 95 (24), 14400-14405 (1998) PUBMED 9826712 REFERENCE 9 (bases 1 to 1621) AUTHORS Jiang,H., Su,Z.Z., Lin,J.J., Goldstein,N.I., Young,C.S. and Fisher,P.B. TITLE The melanoma differentiation associated gene mda-7 suppresses cancer cell growth JOURNAL Proc. Natl. Acad. Sci. U.S.A. 93 (17), 9160-9165 (1996) PUBMED 8799171 REFERENCE 10 (bases 1 to 1621) AUTHORS Jiang,H., Lin,J.J., Su,Z.Z., Goldstein,N.I. and Fisher,P.B. TITLE Subtraction hybridization identifies a novel melanoma differentiation associated gene, mda-7, modulated during human melanoma differentiation, growth and progression JOURNAL Oncogene 11 (12), 2477-2486 (1995) PUBMED 8545104 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BP222545.1, BP222651.1 and AY641441.1. Summary: This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (5, also known as mda-7s) lacks two alternate coding exons, which results in a frameshift in the central and 3' coding regions, compared to variant 1. The encoded isoform (5, also known as MDA-7S) shares the same N-terminus but has a distinct and shorter C-terminus, compared to isoform 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BP222651.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025084, ERS025088 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-28 BP222545.1 1-28 29-494 BP222651.1 27-492 495-1621 AY641441.1 693-1819 FEATURES Location/Qualifiers source 1..1621 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1q32" gene 1..1621 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" /note="interleukin 24" /db_xref="GeneID:11009" /db_xref="HGNC:11346" /db_xref="MIM:604136" exon 1..173 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" /inference="alignment:Splign:1.39.8" exon 174..319 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" /inference="alignment:Splign:1.39.8" misc_feature 270..272 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" /note="upstream in-frame stop codon" CDS 276..467 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" /note="isoform 5 is encoded by transcript variant 5; IL-4-induced secreted protein; suppression of tumorigenicity 16 (melanoma differentiation); melanocyte-associated Mda-7; melanoma differentiation-associated gene 7 protein" /codon_start=1 /product="interleukin-24 isoform 5" /protein_id="NP_001172087.1" /db_xref="GI:297632406" /db_xref="GeneID:11009" /db_xref="HGNC:11346" /db_xref="MIM:604136" /translation="
MNFQQRLQSLWTLASKLRITSRVPGCCSRRFCRTSRKKMRCFPSETVHTGGFCYSGEHSNSWT
" exon 320..382 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" /inference="alignment:Splign:1.39.8" exon 383..457 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" /inference="alignment:Splign:1.39.8" exon 458..1621 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" /inference="alignment:Splign:1.39.8" STS 668..1496 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" /standard_name="IL24_765" /db_xref="UniSTS:277377" polyA_signal 933..938 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" polyA_site 951 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" variation complement(1037) /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" /replace="g" /replace="t" /db_xref="dbSNP:1063304" STS 1108..1280 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" /standard_name="SHGC-76250" /db_xref="UniSTS:58289" polyA_signal 1326..1331 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" polyA_site 1347 /gene="IL24" /gene_synonym="C49A; FISP; IL10B; MDA7; MOB5; ST16" /note="This is an internal polyA site. The 3'-most polyA site has not yet been determined." ORIGIN
gcttgcctgcaaacctttacttctgaaatgacttccacggctgggacgggaaccttccacccacagctatgcctctgattggtgaatggtgaaggtgcctgtctaacttttctgtaaaaagaaccagctgcctccaggcagccagccctcaagcatcacttacaggaccagagggacaagacatgactgtgatgaggagctgctttcgccaatttaacaccaagaagaattgaggctgcttgggaggaaggccaggaggaacacgagactgagagatgaattttcaacagaggctgcaaagcctgtggactttagccagcaagctcaggataacatcacgagtgcccggctgctgcagcaggaggttctgcagaacgtctcgcaagaaaatgagatgttttccatcagagacagtgcacacaggcggtttctgctattccggagagcattcaaacagttggacgtagaagcagctctgaccaaagcccttggggaagtggacattcttctgacctggatgcagaaattctacaagctctgaatgtctagaccaggacctccctccccctggcactggtttgttccctgtgtcatttcaaacagtctcccttcctatgctgttcactggacacttcacgcccttggccatgggtcccattcttggcccaggattattgtcaaagaagtcattctttaagcagcgccagtgacagtcagggaaggtgcctctggatgctgtgaagagtctacagagaagattcttgtatttattacaactctatttaattaatgtcagtatttcaactgaagttctatttatttgtgagactgtaagttacatgaaggcagcagaatattgtgccccatgcttctttacccctcacaatccttgccacagtgtggggcagtggatgggtgcttagtaagtacttaataaactgtggtgctttttttggcctgtctttggattgttaaaaaacagagagggatgcttggatgtaaaactgaacttcagagcatgaaaatcacactgtcttctgatatctgcagggacagagcattggggtgggggtaaggtgcatctgtttgaaaagtaaacgataaaatgtggattaaagtgcccagcacaaagcagatcctcaataaacatttcatttcccacccacactcgccagctcaccccatcatccctttcccttggtgccctccttttttttttatcctagtcattcttccctaatcttccacttgagtgtcaagctgaccttgctgatggtgacattgcacctggatgtactatccaatctgtgatgacattccctgctaataaaagacaacataactcaagtctggcagactttcttctctatttctggatgaatgcccagtgagactgtgttgtacagctagaaaaggccttcttcccaatagcaaggctgtgcatctagcctcaagctctggctgaactttgtggtcgacatcaatctaaagatacagtgtctgactataaccttgttccaaaaacctaggcaaagagtatatgtaggaggtgggatatcacttccatgacataagtgctattgcagagccgtggccacccaggaactcctgactgctttcc
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:11009 -> Molecular function: GO:0005125 [cytokine activity] evidence: IEA GeneID:11009 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:11009 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IEA GeneID:11009 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IEA GeneID:11009 -> Biological process: GO:0030336 [negative regulation of cell migration] evidence: IEA GeneID:11009 -> Biological process: GO:0033136 [serine phosphorylation of STAT3 protein] evidence: IEA GeneID:11009 -> Biological process: GO:0042060 [wound healing] evidence: IEA GeneID:11009 -> Biological process: GO:0042517 [positive regulation of tyrosine phosphorylation of Stat3 protein] evidence: IEA GeneID:11009 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IEA GeneID:11009 -> Biological process: GO:0071222 [cellular response to lipopolysaccharide] evidence: IEA GeneID:11009 -> Biological process: GO:0071353 [cellular response to interleukin-4] evidence: IEA GeneID:11009 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA GeneID:11009 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.