2025-09-16 13:11:29, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_018154 1746 bp mRNA linear PRI 03-MAY-2013 DEFINITION Homo sapiens anti-silencing function 1B histone chaperone (ASF1B), mRNA. ACCESSION NM_018154 VERSION NM_018154.2 GI:67782340 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1746) AUTHORS Zhang,W., Tyl,M., Ward,R., Sobott,F., Maman,J., Murthy,A.S., Watson,A.A., Fedorov,O., Bowman,A., Owen-Hughes,T., El Mkami,H., Murzina,N.V., Norman,D.G. and Laue,E.D. TITLE Structural plasticity of histones H3-H4 facilitates their allosteric exchange between RbAp48 and ASF1 JOURNAL Nat. Struct. Mol. Biol. 20 (1), 29-35 (2013) PUBMED 23178455 REMARK GeneRIF: study of the interaction of the histone H3-H4 complex with the RbAp48 and their exchange with a second histone chaperone, anti-silencing function protein 1 (ASF1); exchange of histones H3-H4 between these two histone chaperones has a central role in the assembly of new nucleosomes REFERENCE 2 (bases 1 to 1746) AUTHORS Corpet,A., De Koning,L., Toedling,J., Savignoni,A., Berger,F., Lemaitre,C., O'Sullivan,R.J., Karlseder,J., Barillot,E., Asselain,B., Sastre-Garau,X. and Almouzni,G. TITLE Asf1b, the necessary Asf1 isoform for proliferation, is predictive of outcome in breast cancer JOURNAL EMBO J. 30 (3), 480-493 (2011) PUBMED 21179005 REMARK GeneRIF: Asf1b, the necessary Asf1 isoform for proliferation, is predictive of outcome in breast cancer. REFERENCE 3 (bases 1 to 1746) AUTHORS Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S. CONSRTM DREAM investigators TITLE Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study JOURNAL Diabetes Care 33 (10), 2250-2253 (2010) PUBMED 20628086 REMARK GeneRIF: Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) REFERENCE 4 (bases 1 to 1746) AUTHORS Jasencakova,Z., Scharf,A.N., Ask,K., Corpet,A., Imhof,A., Almouzni,G. and Groth,A. TITLE Replication stress interferes with histone recycling and predeposition marking of new histones JOURNAL Mol. Cell 37 (5), 736-743 (2010) PUBMED 20227376 REMARK GeneRIF: Identify marks on histones H3-H4 bound to Asf1 and changes induced upon replication stress. REFERENCE 5 (bases 1 to 1746) AUTHORS Peng,H., Nogueira,M.L., Vogel,J.L. and Kristie,T.M. TITLE Transcriptional coactivator HCF-1 couples the histone chaperone Asf1b to HSV-1 DNA replication components JOURNAL Proc. Natl. Acad. Sci. U.S.A. 107 (6), 2461-2466 (2010) PUBMED 20133788 REMARK GeneRIF: Data show that Asf1b localizes with HCF-1 in viral replication foci and depletion of Asf1b results in significantly reduced viral DNA accumulation. REFERENCE 6 (bases 1 to 1746) AUTHORS Girard,A., Sachidanandam,R., Hannon,G.J. and Carmell,M.A. TITLE A germline-specific class of small RNAs binds mammalian Piwi proteins JOURNAL Nature 442 (7099), 199-202 (2006) PUBMED 16751776 REFERENCE 7 (bases 1 to 1746) AUTHORS Groth,A., Ray-Gallet,D., Quivy,J.P., Lukas,J., Bartek,J. and Almouzni,G. TITLE Human Asf1 regulates the flow of S phase histones during replicational stress JOURNAL Mol. Cell 17 (2), 301-311 (2005) PUBMED 15664198 REFERENCE 8 (bases 1 to 1746) AUTHORS Loyola,A. and Almouzni,G. TITLE Histone chaperones, a supporting role in the limelight JOURNAL Biochim. Biophys. Acta 1677 (1-3), 3-11 (2004) PUBMED 15020040 REMARK Review article REFERENCE 9 (bases 1 to 1746) AUTHORS Umehara,T. and Horikoshi,M. TITLE Transcription initiation factor IID-interactive histone chaperone CIA-II implicated in mammalian spermatogenesis JOURNAL J. Biol. Chem. 278 (37), 35660-35667 (2003) PUBMED 12842904 REMARK GeneRIF: data suggest that CIA-II is a histone chaperone and is implicated in the regulation of mammalian spermatogenesis REFERENCE 10 (bases 1 to 1746) AUTHORS Sillje,H.H. and Nigg,E.A. TITLE Identification of human Asf1 chromatin assembly factors as substrates of Tousled-like kinases JOURNAL Curr. Biol. 11 (13), 1068-1073 (2001) PUBMED 11470414 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CN426445.1, AK001466.1 and BC036521.1. On Jun 15, 2005 this sequence version replaced gi:8922548. Summary: This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC036521.1, AK223080.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025085 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-11 CN426445.1 336-346 12-1630 AK001466.1 3-1621 1631-1746 BC036521.1 1595-1710 FEATURES Location/Qualifiers source 1..1746 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19p13.12" gene 1..1746 /gene="ASF1B" /gene_synonym="CIA-II" /note="anti-silencing function 1B histone chaperone" /db_xref="GeneID:55723" /db_xref="HGNC:20996" /db_xref="HPRD:16460" /db_xref="MIM:609190" exon 1..281 /gene="ASF1B" /gene_synonym="CIA-II" /inference="alignment:Splign:1.39.8" CDS 173..781 /gene="ASF1B" /gene_synonym="CIA-II" /note="CCG1-interacting factor A-II; hAsf1; hAsf1b; hCIA-II; anti-silencing function protein 1 homolog B; ASF1 anti-silencing function 1 homolog B" /codon_start=1 /product="histone chaperone ASF1B" /protein_id="NP_060624.1" /db_xref="GI:8922549" /db_xref="CCDS:CCDS12306.1" /db_xref="GeneID:55723" /db_xref="HGNC:20996" /db_xref="HPRD:16460" /db_xref="MIM:609190" /translation="
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI
" misc_feature 173..640 /gene="ASF1B" /gene_synonym="CIA-II" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9NVP2.1); Region: Interaction with histone H3 (By similarity)" misc_feature 173..637 /gene="ASF1B" /gene_synonym="CIA-II" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (Q9NVP2.1); Region: Interaction with CHAF1B" misc_feature 173..634 /gene="ASF1B" /gene_synonym="CIA-II" /note="ASF1 like histone chaperone; Region: ASF1_hist_chap; pfam04729" /db_xref="CDD:147073" misc_feature 764..766 /gene="ASF1B" /gene_synonym="CIA-II" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by TLK2; propagated from UniProtKB/Swiss-Prot (Q9NVP2.1); phosphorylation site" variation 182 /gene="ASF1B" /gene_synonym="CIA-II" /replace="c" /replace="g" /db_xref="dbSNP:11555453" exon 282..397 /gene="ASF1B" /gene_synonym="CIA-II" /inference="alignment:Splign:1.39.8" exon 398..574 /gene="ASF1B" /gene_synonym="CIA-II" /inference="alignment:Splign:1.39.8" exon 575..1731 /gene="ASF1B" /gene_synonym="CIA-II" /inference="alignment:Splign:1.39.8" variation 796 /gene="ASF1B" /gene_synonym="CIA-II" /replace="a" /replace="g" /db_xref="dbSNP:3745463" variation 809 /gene="ASF1B" /gene_synonym="CIA-II" /replace="a" /replace="g" /db_xref="dbSNP:3745464" variation 1252..1255 /gene="ASF1B" /gene_synonym="CIA-II" /replace="" /replace="tagt" /db_xref="dbSNP:3833231" STS 1567..1716 /gene="ASF1B" /gene_synonym="CIA-II" /standard_name="WI-14108" /db_xref="UniSTS:72672" variation 1655 /gene="ASF1B" /gene_synonym="CIA-II" /replace="a" /replace="g" /db_xref="dbSNP:3087661" polyA_signal 1707..1712 /gene="ASF1B" /gene_synonym="CIA-II" polyA_site 1731 /gene="ASF1B" /gene_synonym="CIA-II" ORIGIN
ggaggccggctatttgaaggcggcgcgcggactaggtgcgcacttcagttctcggagagaagaggcgggagtggacctggtcagccctaccccactgaccccaccggacccaggcgcggcctccgccacagccacagcccctgcccctgctgcggcgcggcgaggcgaggcgatggccaaggtgtcggtgctgaacgtggcggtcctggagaacccgagccctttccacagccccttccggttcgagatcagcttcgagtgcagtgaagccctggcggacgacctggagtggaagatcatttatgttggctcggctgagagtgaggaatttgatcagatcctagactcggtgctggtgggccctgtgccagcagggagacacatgtttgtctttcaggccgacgcccccaacccatccctcatcccagagactgatgccgtgggtgtgactgtggtcctcatcacctgcacctaccatggacaggagttcatccgagtgggctactacgtcaacaacgagtacctcaaccctgagctgcgtgagaacccgcccatgaagccagatttctcccagctccagcggaacatcttggcctcgaacccccgggtgacccgcttccatatcaactgggacaacaacatggacaggctggaggccatagagacccaggacccctccctgggctgcggcctcccactcaactgcactcctatcaagggcttggggctccctggctgcatccctggcctcctccctgagaactccatggactgcatctaactgcaggaacccagagtgtcccagcacgccgggaggggcaaccaggcctcccagcgagtcctgcagggcccatctagaggactttgggggccatcagctgcaatccaggtctgtcaaactcagcccctaggaaagaacaggccttgggtctcccctagtcctggccagaaggatgatctcgcttttcctctacaggcctataagaagcaggtacttcagttctaaattctgacttgtgttcttttcgtcttcataaattctaactaaggccactgtgccactgtgcacccttgagtaccattgatccaaagctttcccacagacctccctggcccacctagaggctttcttggtcagtgcctgtcaaggctccagtcctgctgagccaaaggctttgtcattcctttctcttcctgtacatctgagcagacccactccagctttctggtgtcacaggcgggaatgttagttagtaggtagacttagatcccatttctgtcctgctcccaggaagattcttaggtcctcttcaatccagcagcccctcccagaggtgtgatcagcaggatgctgaggaaccatgttgcctttcctgtcaatcacagccaccttcctgttatctcctaaatggatctggcttttcctggaggctgccatggttggaagatggtatcagagggcctgcctgggcagtctgtctccgggccagggtcagggaccctctgcctctggcagccttaacctgtcctctgctaggaccagggtgatttcaagccagggaagcaactgggaccctgaaaactgtccctccccagcccgctccccctctctgtgccctggtccccttgctgccatgtggatgctgttgtgattgctgtttgtatattatcaaaatgtttttatattaaaaatgtttggtctgaaaattaaaagcacttcatttagaatgaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:55723 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:55723 -> Molecular function: GO:0042393 [histone binding] evidence: IEA GeneID:55723 -> Biological process: GO:0006334 [nucleosome assembly] evidence: IEA GeneID:55723 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:55723 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA GeneID:55723 -> Biological process: GO:0007275 [multicellular organismal development] evidence: IEA GeneID:55723 -> Biological process: GO:0007283 [spermatogenesis] evidence: IEA GeneID:55723 -> Biological process: GO:0016568 [chromatin modification] evidence: IEA GeneID:55723 -> Biological process: GO:0030154 [cell differentiation] evidence: IEA GeneID:55723 -> Cellular component: GO:0000785 [chromatin] evidence: IEA GeneID:55723 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.