GGRNA Home | Help | Advanced search

2025-09-16 13:11:29, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_018154               1746 bp    mRNA    linear   PRI 03-MAY-2013
DEFINITION  Homo sapiens anti-silencing function 1B histone chaperone (ASF1B),
            mRNA.
ACCESSION   NM_018154
VERSION     NM_018154.2  GI:67782340
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1746)
  AUTHORS   Zhang,W., Tyl,M., Ward,R., Sobott,F., Maman,J., Murthy,A.S.,
            Watson,A.A., Fedorov,O., Bowman,A., Owen-Hughes,T., El Mkami,H.,
            Murzina,N.V., Norman,D.G. and Laue,E.D.
  TITLE     Structural plasticity of histones H3-H4 facilitates their
            allosteric exchange between RbAp48 and ASF1
  JOURNAL   Nat. Struct. Mol. Biol. 20 (1), 29-35 (2013)
   PUBMED   23178455
  REMARK    GeneRIF: study of the interaction of the histone H3-H4 complex with
            the RbAp48 and their exchange with a second histone chaperone,
            anti-silencing function protein 1 (ASF1); exchange of histones
            H3-H4 between these two histone chaperones has a central role in
            the assembly of new nucleosomes
REFERENCE   2  (bases 1 to 1746)
  AUTHORS   Corpet,A., De Koning,L., Toedling,J., Savignoni,A., Berger,F.,
            Lemaitre,C., O'Sullivan,R.J., Karlseder,J., Barillot,E.,
            Asselain,B., Sastre-Garau,X. and Almouzni,G.
  TITLE     Asf1b, the necessary Asf1 isoform for proliferation, is predictive
            of outcome in breast cancer
  JOURNAL   EMBO J. 30 (3), 480-493 (2011)
   PUBMED   21179005
  REMARK    GeneRIF: Asf1b, the necessary Asf1 isoform for proliferation, is
            predictive of outcome in breast cancer.
REFERENCE   3  (bases 1 to 1746)
  AUTHORS   Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V.,
            Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
  CONSRTM   DREAM investigators
  TITLE     Variation at the NFATC2 locus increases the risk of
            thiazolidinedione-induced edema in the Diabetes REduction
            Assessment with ramipril and rosiglitazone Medication (DREAM) study
  JOURNAL   Diabetes Care 33 (10), 2250-2253 (2010)
   PUBMED   20628086
  REMARK    GeneRIF: Observational study of gene-disease association,
            gene-environment interaction, and pharmacogenomic / toxicogenomic.
            (HuGE Navigator)
REFERENCE   4  (bases 1 to 1746)
  AUTHORS   Jasencakova,Z., Scharf,A.N., Ask,K., Corpet,A., Imhof,A.,
            Almouzni,G. and Groth,A.
  TITLE     Replication stress interferes with histone recycling and
            predeposition marking of new histones
  JOURNAL   Mol. Cell 37 (5), 736-743 (2010)
   PUBMED   20227376
  REMARK    GeneRIF: Identify marks on histones H3-H4 bound to Asf1 and changes
            induced upon replication stress.
REFERENCE   5  (bases 1 to 1746)
  AUTHORS   Peng,H., Nogueira,M.L., Vogel,J.L. and Kristie,T.M.
  TITLE     Transcriptional coactivator HCF-1 couples the histone chaperone
            Asf1b to HSV-1 DNA replication components
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 107 (6), 2461-2466 (2010)
   PUBMED   20133788
  REMARK    GeneRIF: Data show that Asf1b localizes with HCF-1 in viral
            replication foci and depletion of Asf1b results in significantly
            reduced viral DNA accumulation.
REFERENCE   6  (bases 1 to 1746)
  AUTHORS   Girard,A., Sachidanandam,R., Hannon,G.J. and Carmell,M.A.
  TITLE     A germline-specific class of small RNAs binds mammalian Piwi
            proteins
  JOURNAL   Nature 442 (7099), 199-202 (2006)
   PUBMED   16751776
REFERENCE   7  (bases 1 to 1746)
  AUTHORS   Groth,A., Ray-Gallet,D., Quivy,J.P., Lukas,J., Bartek,J. and
            Almouzni,G.
  TITLE     Human Asf1 regulates the flow of S phase histones during
            replicational stress
  JOURNAL   Mol. Cell 17 (2), 301-311 (2005)
   PUBMED   15664198
REFERENCE   8  (bases 1 to 1746)
  AUTHORS   Loyola,A. and Almouzni,G.
  TITLE     Histone chaperones, a supporting role in the limelight
  JOURNAL   Biochim. Biophys. Acta 1677 (1-3), 3-11 (2004)
   PUBMED   15020040
  REMARK    Review article
REFERENCE   9  (bases 1 to 1746)
  AUTHORS   Umehara,T. and Horikoshi,M.
  TITLE     Transcription initiation factor IID-interactive histone chaperone
            CIA-II implicated in mammalian spermatogenesis
  JOURNAL   J. Biol. Chem. 278 (37), 35660-35667 (2003)
   PUBMED   12842904
  REMARK    GeneRIF: data suggest that CIA-II is a histone chaperone and is
            implicated in the regulation of mammalian spermatogenesis
REFERENCE   10 (bases 1 to 1746)
  AUTHORS   Sillje,H.H. and Nigg,E.A.
  TITLE     Identification of human Asf1 chromatin assembly factors as
            substrates of Tousled-like kinases
  JOURNAL   Curr. Biol. 11 (13), 1068-1073 (2001)
   PUBMED   11470414
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CN426445.1, AK001466.1 and
            BC036521.1.
            On Jun 15, 2005 this sequence version replaced gi:8922548.
            
            Summary: This gene encodes a member of the H3/H4 family of histone
            chaperone proteins and is similar to the anti-silencing function-1
            gene in yeast. The encoded protein is the substrate of the
            tousled-like kinase family of cell cycle-regulated kinases, and may
            play a key role in modulating the nucleosome structure of chromatin
            by ensuring a constant supply of histones at sites of nucleosome
            assembly. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC036521.1, AK223080.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-11                CN426445.1         336-346
            12-1630             AK001466.1         3-1621
            1631-1746           BC036521.1         1595-1710
FEATURES             Location/Qualifiers
     source          1..1746
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19p13.12"
     gene            1..1746
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /note="anti-silencing function 1B histone chaperone"
                     /db_xref="GeneID:55723"
                     /db_xref="HGNC:20996"
                     /db_xref="HPRD:16460"
                     /db_xref="MIM:609190"
     exon            1..281
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /inference="alignment:Splign:1.39.8"
     CDS             173..781
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /note="CCG1-interacting factor A-II; hAsf1; hAsf1b;
                     hCIA-II; anti-silencing function protein 1 homolog B; ASF1
                     anti-silencing function 1 homolog B"
                     /codon_start=1
                     /product="histone chaperone ASF1B"
                     /protein_id="NP_060624.1"
                     /db_xref="GI:8922549"
                     /db_xref="CCDS:CCDS12306.1"
                     /db_xref="GeneID:55723"
                     /db_xref="HGNC:20996"
                     /db_xref="HPRD:16460"
                     /db_xref="MIM:609190"
                     /translation="
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI
"
     misc_feature    173..640
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9NVP2.1);
                     Region: Interaction with histone H3 (By similarity)"
     misc_feature    173..637
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9NVP2.1);
                     Region: Interaction with CHAF1B"
     misc_feature    173..634
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /note="ASF1 like histone chaperone; Region:
                     ASF1_hist_chap; pfam04729"
                     /db_xref="CDD:147073"
     misc_feature    764..766
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by TLK2; propagated from
                     UniProtKB/Swiss-Prot (Q9NVP2.1); phosphorylation site"
     variation       182
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11555453"
     exon            282..397
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /inference="alignment:Splign:1.39.8"
     exon            398..574
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /inference="alignment:Splign:1.39.8"
     exon            575..1731
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /inference="alignment:Splign:1.39.8"
     variation       796
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3745463"
     variation       809
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3745464"
     variation       1252..1255
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /replace=""
                     /replace="tagt"
                     /db_xref="dbSNP:3833231"
     STS             1567..1716
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /standard_name="WI-14108"
                     /db_xref="UniSTS:72672"
     variation       1655
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3087661"
     polyA_signal    1707..1712
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
     polyA_site      1731
                     /gene="ASF1B"
                     /gene_synonym="CIA-II"
ORIGIN      
ggaggccggctatttgaaggcggcgcgcggactaggtgcgcacttcagttctcggagagaagaggcgggagtggacctggtcagccctaccccactgaccccaccggacccaggcgcggcctccgccacagccacagcccctgcccctgctgcggcgcggcgaggcgaggcgatggccaaggtgtcggtgctgaacgtggcggtcctggagaacccgagccctttccacagccccttccggttcgagatcagcttcgagtgcagtgaagccctggcggacgacctggagtggaagatcatttatgttggctcggctgagagtgaggaatttgatcagatcctagactcggtgctggtgggccctgtgccagcagggagacacatgtttgtctttcaggccgacgcccccaacccatccctcatcccagagactgatgccgtgggtgtgactgtggtcctcatcacctgcacctaccatggacaggagttcatccgagtgggctactacgtcaacaacgagtacctcaaccctgagctgcgtgagaacccgcccatgaagccagatttctcccagctccagcggaacatcttggcctcgaacccccgggtgacccgcttccatatcaactgggacaacaacatggacaggctggaggccatagagacccaggacccctccctgggctgcggcctcccactcaactgcactcctatcaagggcttggggctccctggctgcatccctggcctcctccctgagaactccatggactgcatctaactgcaggaacccagagtgtcccagcacgccgggaggggcaaccaggcctcccagcgagtcctgcagggcccatctagaggactttgggggccatcagctgcaatccaggtctgtcaaactcagcccctaggaaagaacaggccttgggtctcccctagtcctggccagaaggatgatctcgcttttcctctacaggcctataagaagcaggtacttcagttctaaattctgacttgtgttcttttcgtcttcataaattctaactaaggccactgtgccactgtgcacccttgagtaccattgatccaaagctttcccacagacctccctggcccacctagaggctttcttggtcagtgcctgtcaaggctccagtcctgctgagccaaaggctttgtcattcctttctcttcctgtacatctgagcagacccactccagctttctggtgtcacaggcgggaatgttagttagtaggtagacttagatcccatttctgtcctgctcccaggaagattcttaggtcctcttcaatccagcagcccctcccagaggtgtgatcagcaggatgctgaggaaccatgttgcctttcctgtcaatcacagccaccttcctgttatctcctaaatggatctggcttttcctggaggctgccatggttggaagatggtatcagagggcctgcctgggcagtctgtctccgggccagggtcagggaccctctgcctctggcagccttaacctgtcctctgctaggaccagggtgatttcaagccagggaagcaactgggaccctgaaaactgtccctccccagcccgctccccctctctgtgccctggtccccttgctgccatgtggatgctgttgtgattgctgtttgtatattatcaaaatgtttttatattaaaaatgtttggtctgaaaattaaaagcacttcatttagaatgaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:55723 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:55723 -> Molecular function: GO:0042393 [histone binding] evidence: IEA
            GeneID:55723 -> Biological process: GO:0006334 [nucleosome assembly] evidence: IEA
            GeneID:55723 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:55723 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA
            GeneID:55723 -> Biological process: GO:0007275 [multicellular organismal development] evidence: IEA
            GeneID:55723 -> Biological process: GO:0007283 [spermatogenesis] evidence: IEA
            GeneID:55723 -> Biological process: GO:0016568 [chromatin modification] evidence: IEA
            GeneID:55723 -> Biological process: GO:0030154 [cell differentiation] evidence: IEA
            GeneID:55723 -> Cellular component: GO:0000785 [chromatin] evidence: IEA
            GeneID:55723 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.