Home |
Help |
Advanced search
2025-12-18 19:26:31, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_018154 1746 bp mRNA linear PRI 03-MAY-2013
DEFINITION Homo sapiens anti-silencing function 1B histone chaperone (ASF1B),
mRNA.
ACCESSION NM_018154
VERSION NM_018154.2 GI:67782340
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1746)
AUTHORS Zhang,W., Tyl,M., Ward,R., Sobott,F., Maman,J., Murthy,A.S.,
Watson,A.A., Fedorov,O., Bowman,A., Owen-Hughes,T., El Mkami,H.,
Murzina,N.V., Norman,D.G. and Laue,E.D.
TITLE Structural plasticity of histones H3-H4 facilitates their
allosteric exchange between RbAp48 and ASF1
JOURNAL Nat. Struct. Mol. Biol. 20 (1), 29-35 (2013)
PUBMED 23178455
REMARK GeneRIF: study of the interaction of the histone H3-H4 complex with
the RbAp48 and their exchange with a second histone chaperone,
anti-silencing function protein 1 (ASF1); exchange of histones
H3-H4 between these two histone chaperones has a central role in
the assembly of new nucleosomes
REFERENCE 2 (bases 1 to 1746)
AUTHORS Corpet,A., De Koning,L., Toedling,J., Savignoni,A., Berger,F.,
Lemaitre,C., O'Sullivan,R.J., Karlseder,J., Barillot,E.,
Asselain,B., Sastre-Garau,X. and Almouzni,G.
TITLE Asf1b, the necessary Asf1 isoform for proliferation, is predictive
of outcome in breast cancer
JOURNAL EMBO J. 30 (3), 480-493 (2011)
PUBMED 21179005
REMARK GeneRIF: Asf1b, the necessary Asf1 isoform for proliferation, is
predictive of outcome in breast cancer.
REFERENCE 3 (bases 1 to 1746)
AUTHORS Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V.,
Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
CONSRTM DREAM investigators
TITLE Variation at the NFATC2 locus increases the risk of
thiazolidinedione-induced edema in the Diabetes REduction
Assessment with ramipril and rosiglitazone Medication (DREAM) study
JOURNAL Diabetes Care 33 (10), 2250-2253 (2010)
PUBMED 20628086
REMARK GeneRIF: Observational study of gene-disease association,
gene-environment interaction, and pharmacogenomic / toxicogenomic.
(HuGE Navigator)
REFERENCE 4 (bases 1 to 1746)
AUTHORS Jasencakova,Z., Scharf,A.N., Ask,K., Corpet,A., Imhof,A.,
Almouzni,G. and Groth,A.
TITLE Replication stress interferes with histone recycling and
predeposition marking of new histones
JOURNAL Mol. Cell 37 (5), 736-743 (2010)
PUBMED 20227376
REMARK GeneRIF: Identify marks on histones H3-H4 bound to Asf1 and changes
induced upon replication stress.
REFERENCE 5 (bases 1 to 1746)
AUTHORS Peng,H., Nogueira,M.L., Vogel,J.L. and Kristie,T.M.
TITLE Transcriptional coactivator HCF-1 couples the histone chaperone
Asf1b to HSV-1 DNA replication components
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 107 (6), 2461-2466 (2010)
PUBMED 20133788
REMARK GeneRIF: Data show that Asf1b localizes with HCF-1 in viral
replication foci and depletion of Asf1b results in significantly
reduced viral DNA accumulation.
REFERENCE 6 (bases 1 to 1746)
AUTHORS Girard,A., Sachidanandam,R., Hannon,G.J. and Carmell,M.A.
TITLE A germline-specific class of small RNAs binds mammalian Piwi
proteins
JOURNAL Nature 442 (7099), 199-202 (2006)
PUBMED 16751776
REFERENCE 7 (bases 1 to 1746)
AUTHORS Groth,A., Ray-Gallet,D., Quivy,J.P., Lukas,J., Bartek,J. and
Almouzni,G.
TITLE Human Asf1 regulates the flow of S phase histones during
replicational stress
JOURNAL Mol. Cell 17 (2), 301-311 (2005)
PUBMED 15664198
REFERENCE 8 (bases 1 to 1746)
AUTHORS Loyola,A. and Almouzni,G.
TITLE Histone chaperones, a supporting role in the limelight
JOURNAL Biochim. Biophys. Acta 1677 (1-3), 3-11 (2004)
PUBMED 15020040
REMARK Review article
REFERENCE 9 (bases 1 to 1746)
AUTHORS Umehara,T. and Horikoshi,M.
TITLE Transcription initiation factor IID-interactive histone chaperone
CIA-II implicated in mammalian spermatogenesis
JOURNAL J. Biol. Chem. 278 (37), 35660-35667 (2003)
PUBMED 12842904
REMARK GeneRIF: data suggest that CIA-II is a histone chaperone and is
implicated in the regulation of mammalian spermatogenesis
REFERENCE 10 (bases 1 to 1746)
AUTHORS Sillje,H.H. and Nigg,E.A.
TITLE Identification of human Asf1 chromatin assembly factors as
substrates of Tousled-like kinases
JOURNAL Curr. Biol. 11 (13), 1068-1073 (2001)
PUBMED 11470414
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from CN426445.1, AK001466.1 and
BC036521.1.
On Jun 15, 2005 this sequence version replaced gi:8922548.
Summary: This gene encodes a member of the H3/H4 family of histone
chaperone proteins and is similar to the anti-silencing function-1
gene in yeast. The encoded protein is the substrate of the
tousled-like kinase family of cell cycle-regulated kinases, and may
play a key role in modulating the nucleosome structure of chromatin
by ensuring a constant supply of histones at sites of nucleosome
assembly. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC036521.1, AK223080.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025085 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-11 CN426445.1 336-346
12-1630 AK001466.1 3-1621
1631-1746 BC036521.1 1595-1710
FEATURES Location/Qualifiers
source 1..1746
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19p13.12"
gene 1..1746
/gene="ASF1B"
/gene_synonym="CIA-II"
/note="anti-silencing function 1B histone chaperone"
/db_xref="GeneID:55723"
/db_xref="HGNC:20996"
/db_xref="HPRD:16460"
/db_xref="MIM:609190"
exon 1..281
/gene="ASF1B"
/gene_synonym="CIA-II"
/inference="alignment:Splign:1.39.8"
CDS 173..781
/gene="ASF1B"
/gene_synonym="CIA-II"
/note="CCG1-interacting factor A-II; hAsf1; hAsf1b;
hCIA-II; anti-silencing function protein 1 homolog B; ASF1
anti-silencing function 1 homolog B"
/codon_start=1
/product="histone chaperone ASF1B"
/protein_id="NP_060624.1"
/db_xref="GI:8922549"
/db_xref="CCDS:CCDS12306.1"
/db_xref="GeneID:55723"
/db_xref="HGNC:20996"
/db_xref="HPRD:16460"
/db_xref="MIM:609190"
/translation="
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI
"
misc_feature 173..640
/gene="ASF1B"
/gene_synonym="CIA-II"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9NVP2.1);
Region: Interaction with histone H3 (By similarity)"
misc_feature 173..637
/gene="ASF1B"
/gene_synonym="CIA-II"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9NVP2.1);
Region: Interaction with CHAF1B"
misc_feature 173..634
/gene="ASF1B"
/gene_synonym="CIA-II"
/note="ASF1 like histone chaperone; Region:
ASF1_hist_chap; pfam04729"
/db_xref="CDD:147073"
misc_feature 764..766
/gene="ASF1B"
/gene_synonym="CIA-II"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by TLK2; propagated from
UniProtKB/Swiss-Prot (Q9NVP2.1); phosphorylation site"
variation 182
/gene="ASF1B"
/gene_synonym="CIA-II"
/replace="c"
/replace="g"
/db_xref="dbSNP:11555453"
exon 282..397
/gene="ASF1B"
/gene_synonym="CIA-II"
/inference="alignment:Splign:1.39.8"
exon 398..574
/gene="ASF1B"
/gene_synonym="CIA-II"
/inference="alignment:Splign:1.39.8"
exon 575..1731
/gene="ASF1B"
/gene_synonym="CIA-II"
/inference="alignment:Splign:1.39.8"
variation 796
/gene="ASF1B"
/gene_synonym="CIA-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:3745463"
variation 809
/gene="ASF1B"
/gene_synonym="CIA-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:3745464"
variation 1252..1255
/gene="ASF1B"
/gene_synonym="CIA-II"
/replace=""
/replace="tagt"
/db_xref="dbSNP:3833231"
STS 1567..1716
/gene="ASF1B"
/gene_synonym="CIA-II"
/standard_name="WI-14108"
/db_xref="UniSTS:72672"
variation 1655
/gene="ASF1B"
/gene_synonym="CIA-II"
/replace="a"
/replace="g"
/db_xref="dbSNP:3087661"
polyA_signal 1707..1712
/gene="ASF1B"
/gene_synonym="CIA-II"
polyA_site 1731
/gene="ASF1B"
/gene_synonym="CIA-II"
ORIGIN
ggaggccggctatttgaaggcggcgcgcggactaggtgcgcacttcagttctcggagagaagaggcgggagtggacctggtcagccctaccccactgaccccaccggacccaggcgcggcctccgccacagccacagcccctgcccctgctgcggcgcggcgaggcgaggcgatggccaaggtgtcggtgctgaacgtggcggtcctggagaacccgagccctttccacagccccttccggttcgagatcagcttcgagtgcagtgaagccctggcggacgacctggagtggaagatcatttatgttggctcggctgagagtgaggaatttgatcagatcctagactcggtgctggtgggccctgtgccagcagggagacacatgtttgtctttcaggccgacgcccccaacccatccctcatcccagagactgatgccgtgggtgtgactgtggtcctcatcacctgcacctaccatggacaggagttcatccgagtgggctactacgtcaacaacgagtacctcaaccctgagctgcgtgagaacccgcccatgaagccagatttctcccagctccagcggaacatcttggcctcgaacccccgggtgacccgcttccatatcaactgggacaacaacatggacaggctggaggccatagagacccaggacccctccctgggctgcggcctcccactcaactgcactcctatcaagggcttggggctccctggctgcatccctggcctcctccctgagaactccatggactgcatctaactgcaggaacccagagtgtcccagcacgccgggaggggcaaccaggcctcccagcgagtcctgcagggcccatctagaggactttgggggccatcagctgcaatccaggtctgtcaaactcagcccctaggaaagaacaggccttgggtctcccctagtcctggccagaaggatgatctcgcttttcctctacaggcctataagaagcaggtacttcagttctaaattctgacttgtgttcttttcgtcttcataaattctaactaaggccactgtgccactgtgcacccttgagtaccattgatccaaagctttcccacagacctccctggcccacctagaggctttcttggtcagtgcctgtcaaggctccagtcctgctgagccaaaggctttgtcattcctttctcttcctgtacatctgagcagacccactccagctttctggtgtcacaggcgggaatgttagttagtaggtagacttagatcccatttctgtcctgctcccaggaagattcttaggtcctcttcaatccagcagcccctcccagaggtgtgatcagcaggatgctgaggaaccatgttgcctttcctgtcaatcacagccaccttcctgttatctcctaaatggatctggcttttcctggaggctgccatggttggaagatggtatcagagggcctgcctgggcagtctgtctccgggccagggtcagggaccctctgcctctggcagccttaacctgtcctctgctaggaccagggtgatttcaagccagggaagcaactgggaccctgaaaactgtccctccccagcccgctccccctctctgtgccctggtccccttgctgccatgtggatgctgttgtgattgctgtttgtatattatcaaaatgtttttatattaaaaatgtttggtctgaaaattaaaagcacttcatttagaatgaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:55723 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:55723 -> Molecular function: GO:0042393 [histone binding] evidence: IEA
GeneID:55723 -> Biological process: GO:0006334 [nucleosome assembly] evidence: IEA
GeneID:55723 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
GeneID:55723 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA
GeneID:55723 -> Biological process: GO:0007275 [multicellular organismal development] evidence: IEA
GeneID:55723 -> Biological process: GO:0007283 [spermatogenesis] evidence: IEA
GeneID:55723 -> Biological process: GO:0016568 [chromatin modification] evidence: IEA
GeneID:55723 -> Biological process: GO:0030154 [cell differentiation] evidence: IEA
GeneID:55723 -> Cellular component: GO:0000785 [chromatin] evidence: IEA
GeneID:55723 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.