LOCUS       NM_024787               1872 bp    mRNA    linear   PRI 19-JUL-2013
DEFINITION  Homo sapiens ring finger protein 122 (RNF122), mRNA.
ACCESSION   NM_024787
VERSION     NM_024787.3  GI:525345373
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1872)
  AUTHORS   Wang L, Gao X, Gao P, Deng W, Yu P, Ma J, Guo J, Wang X, Cheng H,
            Zhang C, Yu C, Ma X, Lv B, Lu Y, Shi T and Ma D.
  TITLE     Cell-based screening and validation of human novel genes associated
            with cell viability
  JOURNAL   J Biomol Screen 11 (4), 369-376 (2006)
   PUBMED   16751333
REFERENCE   2  (bases 1 to 1872)
  AUTHORS   Saurin AJ, Borden KL, Boddy MN and Freemont PS.
  TITLE     Does this have a familiar RING?
  JOURNAL   Trends Biochem. Sci. 21 (6), 208-214 (1996)
   PUBMED   8744354
REFERENCE   3  (bases 1 to 1872)
  AUTHORS   Koyama K, Sudo K and Nakamura Y.
  TITLE     Isolation of 115 human chromosome 8-specific expressed-sequence
            tags by exon amplification
  JOURNAL   Genomics 26 (2), 245-253 (1995)
   PUBMED   7601449
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DA610129.1, DA904646.1,
            BC093884.1 and AC013603.17.
            On Jul 19, 2013 this sequence version replaced gi:38045930.
            
            Summary: The encoded protein contains a RING finger, a motif
            present in a variety of functionally distinct proteins and known to
            be involved in protein-protein and protein-DNA interactions. The
            encoded protein is localized to the endoplasmic reticulum and golgi
            apparatus, and may be associated with cell viability. [provided by
            RefSeq, Jul 2013].
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK022588.1, BC093884.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-2                 DA610129.1         1-2
            3-382               DA904646.1         1-380
            383-896             BC093884.1         1-514
            897-1872            AC013603.17        37158-38133         c
FEATURES             Location/Qualifiers
     source          1..1872
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8p12"
     gene            1..1872
                     /gene="RNF122"
                     /note="ring finger protein 122"
                     /db_xref="GeneID:79845"
                     /db_xref="HGNC:21147"
                     /db_xref="HPRD:11498"
     misc_feature    226..228
                     /gene="RNF122"
                     /note="upstream in-frame stop codon"
     CDS             406..873
                     /gene="RNF122"
                     /codon_start=1
                     /product="RING finger protein 122"
                     /protein_id="NP_079063.2"
                     /db_xref="GI:38045931"
                     /db_xref="CCDS:CCDS6091.1"
                     /db_xref="GeneID:79845"
                     /db_xref="HGNC:21147"
                     /db_xref="HPRD:11498"
                     /translation="

MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDELV

"
     misc_feature    523..585
                     /gene="RNF122"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H9V4.2);
                     transmembrane region"
     misc_feature    679..816
                     /gene="RNF122"
                     /note="RING-finger (Really Interesting New Gene) domain, a
                     specialized type of Zn-finger of 40 to 60 residues that
                     binds two atoms of zinc; defined by the 'cross-brace'
                     motif C-X2-C-X(9-39)-C-X(1-3)-
                     H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved
                     in...; Region: RING; cd00162"
                     /db_xref="CDD:29102"
     misc_feature    order(682..684,691..693,736..738,742..744,751..753,
                     760..762,793..795,802..804)
                     /gene="RNF122"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:29102"
     polyA_signal    1842..1847
                     /gene="RNF122"
     polyA_site      1872
                     /gene="RNF122"
ORIGIN      

gtcagtttcggaaccccagccagctcacctctgcgccgctgaacccgatccgagcctccggcaaaggtttttccctcctcccccggccgagggcttctgcagcccgggcacccccgccccgcggcgccccacattcccccagcccggggcccttggcgcgtgcgctccgtgcggctgtgctccgcgggactttgtttgtttcctcctcgtccctctttgttgggctgaacaccagcctcgtcaaagccccccactccggagggagttcggcttctccagcagggcggctgcagcgcgctgccccgaccccgcctgcggcccctcacgccgctagtgctcccaccccgccctcctggcaccccgcctgcgtccgttcgcccgaggaagccaaccgcgacttcattgatgcacccattccagtggtgtaacgggtgtttctgtggcctgggactggttagcaccaacaagtcctgctcgatgccacccatcagtttccaggaccttccgctcaacatctatatggtcatcttcggcacaggcatctttgtcttcatgctcagccttatcttctgctgctattttatcagcaaactgcggaaccaggcacagagtgagcgatacggatataaggaggtggtgcttaaaggtgatgccaagaagttacaattatatgggcagacctgcgcagtctgtctggaagacttcaaggggaaggatgagttaggcgtgctcccgtgccaacacgcctttcaccgcaagtgtctggtgaaatggctggaagttcgctgtgtctgccccatgtgtaacaagcccattgctagtccctcagaggccacgcagaacattgggattctattggatgagctggtgtgagtgctgccgctacaccgagacctggagaagacctcttgcctcatggatgtctggtccctctgcacagctccaaccaacaggactgtagggtgatgacgatcactttcccagtgatgagaagggtggtctaggactgggcttctaccctcagtgcaagaccagtgccagatgtgcccccacttcctgcctcctgaagccttcttccctgctactccatgctggtggcctcacccatcaagaccactgtctcctggtactggactatctacctgccttgtccctgttctgggggaaggtgtccaccccgatcaagaacatggagaaagtcctctttcaaggctcccattaggaggatgagctgccttgacccagaagggatgagacgggctcttacctctctacaaccttccctccccttcccactccttccggagtaaggttagaagggaaggaaggaaagatcaaggaaccaagcgcctccacgggaggcgagggaggctctgtatgaaacagaagagcagggacataaaggaaaatgtcagtgtttacatgggacctatggaaacaaaggctggcgggcgccagctgactccagagtaagagagggcccttcccctgccaggacccacggtgctatccattcagtctcttcctcagttaatctcggagcttcctattccatgttgaggtttgtgggcccctctagaggagggctagttctatacttaaattgattcccaggggccttttttttttttttttttttttttttgatcaaaaggggtgtggggatgggggtgtctacggttaagcaacagatacctccttccctttgtaaatagtatttttatacttcatcctcgcctctcaggctttagatacgaaatctccagaatggaagggggtggggattttctgttcctccctggagtgggtgagggtgggagaaagttacatatttaaagaaaaataaatttaataacaagtttctctaaccta

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:79845 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IEA
            GeneID:79845 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: IEA
            GeneID:79845 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IEA
            GeneID:79845 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA