GGRNA | NM_024626.3

LOCUS       NM_024626               2652 bp    mRNA    linear   PRI 02-JUN-2013
DEFINITION  Homo sapiens V-set domain containing T cell activation inhibitor 1
            (VTCN1), transcript variant 1, mRNA.
ACCESSION   NM_024626
VERSION     NM_024626.3  GI:359718942
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2652)
  AUTHORS   Abadi,Y.M., Jeon,H., Ohaegbulam,K.C., Scandiuzzi,L., Ghosh,K.,
            Hofmeyer,K.A., Lee,J.S., Ray,A., Gravekamp,C. and Zang,X.
  TITLE     Host b7x promotes pulmonary metastasis of breast cancer
  JOURNAL   J. Immunol. 190 (7), 3806-3814 (2013)
   PUBMED   23455497
  REMARK    GeneRIF: B7x may enable metastasizing cancer cells to escape local
            antitumor immune responses through interactions with the innate and
            adaptive immune systems.
REFERENCE   2  (bases 1 to 2652)
  AUTHORS   Fauci,J.M., Straughn,J.M. Jr., Ferrone,S. and Buchsbaum,D.J.
  TITLE     A review of B7-H3 and B7-H4 immune molecules and their role in
            ovarian cancer
  JOURNAL   Gynecol. Oncol. 127 (2), 420-425 (2012)
   PUBMED   22910694
  REMARK    GeneRIF: A review of B7-H3 and B7-H4 immune molecules and the role
            their overexpression plays in ovarian cancer.
            Review article
REFERENCE   3  (bases 1 to 2652)
  AUTHORS   Galazka,K., Oplawski,M., Windorbska,W., Skret-Magierlo,J.,
            Koper,K., Basta,P., Mach,P., Dutch-Wicherek,M., Mazur,A. and
            Wicherek,L.
  TITLE     The immunohistochemical analysis of antigens such as RCAS1 and B7H4
            in the cervical cancer nest and within the fibroblasts and
            macrophages infiltrating the cancer microenvironment
  JOURNAL   Am. J. Reprod. Immunol. 68 (1), 85-93 (2012)
   PUBMED   22530960
  REMARK    GeneRIF: The intensity of the suppressive profile of the cervical
            cancer microenvironment indicated by the presence of both RCAS1 and
            B7H4 on the front of the tumor and in the macrophages and
            fibroblasts infiltrating the cancer stroma
REFERENCE   4  (bases 1 to 2652)
  AUTHORS   Zheng,X., Li,X.D., Wu,C.P., Lu,B.F. and Jiang,J.T.
  TITLE     Expression of costimulatory molecule B7-H4 in human malignant
            tumors
  JOURNAL   Onkologie 35 (11), 700-705 (2012)
   PUBMED   23147549
  REMARK    GeneRIF: B7-H4 expression in malignant tumors is useful for
            clinical diagnosis, and may provide a novel molecular target for
            cancer treatment.[review]
            Review article
REFERENCE   5  (bases 1 to 2652)
  AUTHORS   Sun,S.Q., Jiang,C.G., Lin,Y., Jin,Y.L. and Huang,P.L.
  TITLE     Enhanced T cell immunity by B7-H4 downregulation in nonsmall-cell
            lung cancer cell lines
  JOURNAL   J. Int. Med. Res. 40 (2), 497-506 (2012)
   PUBMED   22613410
  REMARK    GeneRIF: study concludes B7-H4 negatively regulates T cell-mediated
            antitumour immunity in nonsmall-cell lung cancer
REFERENCE   6  (bases 1 to 2652)
  AUTHORS   Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J.,
            Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B.,
            Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E.,
            Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S.,
            Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C.,
            Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V.,
            Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K.,
            Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z.,
            Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
  TITLE     The secreted protein discovery initiative (SPDI), a large-scale
            effort to identify novel human secreted and transmembrane proteins:
            a bioinformatics assessment
  JOURNAL   Genome Res. 13 (10), 2265-2270 (2003)
   PUBMED   12975309
  REMARK    Erratum:[Genome Res. 2003 Dec;13(12):2759]
REFERENCE   7  (bases 1 to 2652)
  AUTHORS   Zang,X., Loke,P., Kim,J., Murphy,K., Waitz,R. and Allison,J.P.
  TITLE     B7x: a widely expressed B7 family member that inhibits T cell
            activation
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 100 (18), 10388-10392 (2003)
   PUBMED   12920180
REFERENCE   8  (bases 1 to 2652)
  AUTHORS   Watanabe,N., Gavrieli,M., Sedy,J.R., Yang,J., Fallarino,F.,
            Loftin,S.K., Hurchla,M.A., Zimmerman,N., Sim,J., Zang,X.,
            Murphy,T.L., Russell,J.H., Allison,J.P. and Murphy,K.M.
  TITLE     BTLA is a lymphocyte inhibitory receptor with similarities to
            CTLA-4 and PD-1
  JOURNAL   Nat. Immunol. 4 (7), 670-679 (2003)
   PUBMED   12796776
REFERENCE   9  (bases 1 to 2652)
  AUTHORS   Prasad,D.V., Richards,S., Mai,X.M. and Dong,C.
  TITLE     B7S1, a novel B7 family member that negatively regulates T cell
            activation
  JOURNAL   Immunity 18 (6), 863-873 (2003)
   PUBMED   12818166
  REMARK    GeneRIF: Negative regulator of T cell activation.  (B7S1)
REFERENCE   10 (bases 1 to 2652)
  AUTHORS   Sica,G.L., Choi,I.H., Zhu,G., Tamada,K., Wang,S.D., Tamura,H.,
            Chapoval,A.I., Flies,D.B., Bajorath,J. and Chen,L.
  TITLE     B7-H4, a molecule of the B7 family, negatively regulates T cell
            immunity
  JOURNAL   Immunity 18 (6), 849-861 (2003)
   PUBMED   12818165
  REMARK    GeneRIF: May participate in negative regulation of cell-mediated
            immunity in peripheral tissues
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DC347131.1, DB198367.1, AY280972.1, CN259811.1, AL391476.20 and
            AI686571.1.
            On Dec 8, 2011 this sequence version replaced gi:99028880.
            
            Summary: This gene encodes a protein belonging to the B7
            costimulatory protein family. Proteins in this family are present
            on the surface of antigen-presenting cells and interact with ligand
            bound to receptors on the surface of T cells. Studies have shown
            that high levels of the encoded protein has been correlated with
            tumor progression. A pseudogene of this gene is located on
            chromosome 20. Multiple transcript variants encoding different
            isoforms have been found for this gene. [provided by RefSeq, Dec
            2011].
            
            Transcript Variant: This variant (1) encodes the longest protein
            (isoform 1).
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY358352.1, AK026071.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-33                DC347131.1         1-33
            34-105              DB198367.1         1-72
            106-954             AY280972.1         1-849
            955-1087            CN259811.1         523-655
            1088-2205           AL391476.20        81082-82199         c
            2206-2652           AI686571.1         1-447               c
FEATURES             Location/Qualifiers
     source          1..2652
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1p13.1"
     gene            1..2652
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /note="V-set domain containing T cell activation inhibitor
                     1"
                     /db_xref="GeneID:79679"
                     /db_xref="HGNC:28873"
                     /db_xref="MIM:608162"
     exon            1..137
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /inference="alignment:Splign:1.39.8"
     STS             75..990
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /db_xref="UniSTS:481957"
     CDS             106..954
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /note="isoform 1 precursor is encoded by transcript
                     variant 1; B7 family member, H4; immune costimulatory
                     protein B7-H4; V-set domain-containing T-cell activation
                     inhibitor 1; T cell costimulatory molecule B7x; B7
                     superfamily member 1; T-cell costimulatory molecule B7x"
                     /codon_start=1
                     /product="V-set domain-containing T-cell activation
                     inhibitor 1 isoform 1 precursor"
                     /protein_id="NP_078902.2"
                     /db_xref="GI:99028881"
                     /db_xref="CCDS:CCDS894.1"
                     /db_xref="GeneID:79679"
                     /db_xref="HGNC:28873"
                     /db_xref="MIM:608162"
                     /translation="

MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK

"
     sig_peptide     106..177
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="Potential; propagated from UniProtKB/Swiss-Prot
                     (Q7Z7D3.1)"
     mat_peptide     178..951
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /product="V-set domain-containing T-cell activation
                     inhibitor 1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q7Z7D3.1)"
     misc_feature    211..510
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /note="Immunoglobulin V-set domain; Region: V-set;
                     pfam07686"
                     /db_xref="CDD:203725"
     misc_feature    250..543
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:213125"
     misc_feature    883..945
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q7Z7D3.1);
                     transmembrane region"
     exon            138..202
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /inference="alignment:Splign:1.39.8"
     exon            203..550
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /inference="alignment:Splign:1.39.8"
     exon            551..829
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /inference="alignment:Splign:1.39.8"
     exon            830..999
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /inference="alignment:Splign:1.39.8"
     exon            1000..2638
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /inference="alignment:Splign:1.39.8"
     variation       1722
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1937956"
     variation       2355
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:13505"
     STS             2448..2572
                     /gene="VTCN1"
                     /gene_synonym="B7-H4; B7h.5; B7H4; B7S1; B7X; PRO1291;
                     RP11-229A19.4; VCTN1"
                     /standard_name="SHGC-75394"
                     /db_xref="UniSTS:7059"
ORIGIN

acactatttaaggccaatacacgggagctggttgtgagtcaccaaggaaggcagcggcagctccactcagccagtacccagatacgctgggaaccttccccagccatggcttccctggggcagatcctcttctggagcataattagcatcatcattattctggctggagcaattgcactcatcattggctttggtatttcagggagacactccatcacagtcactactgtcgcctcagctgggaacattggggaggatggaatcctgagctgcacttttgaacctgacatcaaactttctgatatcgtgatacaatggctgaaggaaggtgttttaggcttggtccatgagttcaaagaaggcaaagatgagctgtcggagcaggatgaaatgttcagaggccggacagcagtgtttgctgatcaagtgatagttggcaatgcctctttgcggctgaaaaacgtgcaactcacagatgctggcacctacaaatgttatatcatcacttctaaaggcaaggggaatgctaaccttgagtataaaactggagccttcagcatgccggaagtgaatgtggactataatgccagctcagagaccttgcggtgtgaggctccccgatggttcccccagcccacagtggtctgggcatcccaagttgaccagggagccaacttctcggaagtctccaataccagctttgagctgaactctgagaatgtgaccatgaaggttgtgtctgtgctctacaatgttacgatcaacaacacatactcctgtatgattgaaaatgacattgccaaagcaacaggggatatcaaagtgacagaatcggagatcaaaaggcggagtcacctacagctgctaaactcaaaggcttctctgtgtgtctcttctttctttgccatcagctgggcacttctgcctctcagcccttacctgatgctaaaataatgtgcctcggccacaaaaaagcatgcaaagtcattgttacaacagggatctacagaactatttcaccaccagatatgacctagttttatatttctgggaggaaatgaattcatatctagaagtctggagtgagcaaacaagagcaagaaacaaaaagaagccaaaagcagaaggctccaatatgaacaagataaatctatcttcaaagacatattagaagttgggaaaataattcatgtgaactagacaagtgtgttaagagtgataagtaaaatgcacgtggagacaagtgcatccccagatctcagggacctccccctgcctgtcacctggggagtgagaggacaggatagtgcatgttctttgtctctgaatttttagttatatgtgctgtaatgttgctctgaggaagcccctggaaagtctatcccaacatatccacatcttatattccacaaattaagctgtagtatgtaccctaagacgctgctaattgactgccacttcgcaactcaggggcggctgcattttagtaatgggtcaaatgattcactttttatgatgcttccaaaggtgccttggcttctcttcccaactgacaaatgccaaagttgagaaaaatgatcataattttagcataaacagagcagtcggcgacaccgattttataaataaactgagcaccttctttttaaacaaacaaatgcgggtttatttctcagatgatgttcatccgtgaatggtccagggaaggacctttcaccttgtctatatggcattatgtcatcacaagctctgaggcttctcctttccatcctgcgtggacagctaagacctcagttttcaatagcatctagagcagtgggactcagctggggtgatttcgccccccatctccgggggaatgtctgaagacaattttggttacctcaatgagggagtggaggaggatacagtgctactaccaactagtggatagaggccagggatgctgctcaacctcctaccatgtacaggacgtctccccattacaactacccaatccgaagtgtcaactgtgtcagggctaagaaaccctggttttgagtagaaaagggcctggaaagaggggagccaacaaatctgtctgcttcctcacattagtcattggcaaataagcattctgtctctttggctgctgcctcagcacagagagccagaactctatcgggcaccaggataacatctctcagtgaacagagttgacaaggcctatgggaaatgcctgatgggattatcttcagcttgttgagcttctaagtttctttcccttcattctaccctgcaagccaagttctgtaagagaaatgcctgagttctagctcaggttttcttactctgaatttagatctccagaccctgcctggccacaattcaaattaaggcaacaaacatataccttccatgaagcacacacagacttttgaaagcaaggacaatgactgcttgaattgaggccttgaggaatgaagctttgaaggaaaagaatactttgtttccagcccccttcccacactcttcatgtgttaaccactgccttcctggaccttggagccacggtgactgtattacatgttgttatagaaaactgattttagagttctgatcgttcaagagaatgattaaatatacatttcctacaccaaaaaaaaaaaaaaa

//

Annotations: