GGRNA Home | Help | Advanced search

2025-09-17 22:31:32, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_014252               4038 bp    mRNA    linear   PRI 07-JUL-2013
DEFINITION  Homo sapiens solute carrier family 25 (mitochondrial carrier;
            ornithine transporter) member 15 (SLC25A15), mRNA.
ACCESSION   NM_014252
VERSION     NM_014252.3  GI:237649033
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4038)
  AUTHORS   Yamazaki,K., Umeno,J., Takahashi,A., Hirano,A., Johnson,T.A.,
            Kumasaka,N., Morizono,T., Hosono,N., Kawaguchi,T., Takazoe,M.,
            Yamada,T., Suzuki,Y., Tanaka,H., Motoya,S., Hosokawa,M.,
            Arimura,Y., Shinomura,Y., Matsui,T., Matsumoto,T., Iida,M.,
            Tsunoda,T., Nakamura,Y., Kamatani,N. and Kubo,M.
  TITLE     A genome-wide association study identifies 2 susceptibility Loci
            for Crohn's disease in a Japanese population
  JOURNAL   Gastroenterology 144 (4), 781-788 (2013)
   PUBMED   23266558
REFERENCE   2  (bases 1 to 4038)
  AUTHORS   Palmieri,F.
  TITLE     The mitochondrial transporter family SLC25: identification,
            properties and physiopathology
  JOURNAL   Mol. Aspects Med. 34 (2-3), 465-484 (2013)
   PUBMED   23266187
  REMARK    GeneRIF: Compares and contrasts all the known human SLC25A* genes
            and includes functional information.
REFERENCE   3  (bases 1 to 4038)
  AUTHORS   Kim,S.Z., Song,W.J., Nyhan,W.L., Ficicioglu,C., Mandell,R. and
            Shih,V.E.
  TITLE     Long-term follow-up of four patients affected by HHH syndrome
  JOURNAL   Clin. Chim. Acta 413 (13-14), 1151-1155 (2012)
   PUBMED   22465082
  REMARK    GeneRIF: Mutation analysis revealed two novel mutations in the
            ORNT1 gene.
REFERENCE   4  (bases 1 to 4038)
  AUTHORS   Monne,M., Miniero,D.V., Daddabbo,L., Robinson,A.J., Kunji,E.R. and
            Palmieri,F.
  TITLE     Substrate specificity of the two mitochondrial ornithine carriers
            can be swapped by single mutation in substrate binding site
  JOURNAL   J. Biol. Chem. 287 (11), 7925-7934 (2012)
   PUBMED   22262851
  REMARK    GeneRIF: characterized mutations of the proposed substrate binding
            site in ORC1 and ORC2; demonstrated that the residue at position
            179 in the 2 soforms is largely responsible for the difference in
            their substrate specificity;concluded that Arg-179 is a key residue
            in the opening of the carrier to the matrix side
REFERENCE   5  (bases 1 to 4038)
  AUTHORS   Wang,J.F. and Chou,K.C.
  TITLE     Insights into the mutation-induced HHH syndrome from modeling human
            mitochondrial ornithine transporter-1
  JOURNAL   PLoS ONE 7 (1), E31048 (2012)
   PUBMED   22292090
  REMARK    GeneRIF: Useful insights for in-depth understanding of the
            molecular mechanism of the HHH syndrome and developing effective
            drugs against the disease.
REFERENCE   6  (bases 1 to 4038)
  AUTHORS   Salvi,S., Dionisi-Vici,C., Bertini,E., Verardo,M. and
            Santorelli,F.M.
  TITLE     Seven novel mutations in the ORNT1 gene (SLC25A15) in patients with
            hyperornithinemia, hyperammonemia, and homocitrullinuria syndrome
  JOURNAL   Hum. Mutat. 18 (5), 460 (2001)
   PUBMED   11668643
  REMARK    GeneRIF: novel mutations in patients with hyperornithinemia,
            hyperammonemia, and homocitrullinuria syndrome
REFERENCE   7  (bases 1 to 4038)
  AUTHORS   Salvi,S., Santorelli,F.M., Bertini,E., Boldrini,R., Meli,C.,
            Donati,A., Burlina,A.B., Rizzo,C., Di Capua,M., Fariello,G. and
            Dionisi-Vici,C.
  TITLE     Clinical and molecular findings in
            hyperornithinemia-hyperammonemia-homocitrullinuria syndrome
  JOURNAL   Neurology 57 (5), 911-914 (2001)
   PUBMED   11552031
REFERENCE   8  (bases 1 to 4038)
  AUTHORS   Miyamoto,T., Kanazawa,N., Kato,S., Kawakami,M., Inoue,Y.,
            Kuhara,T., Inoue,T., Takeshita,K. and Tsujino,S.
  TITLE     Diagnosis of Japanese patients with HHH syndrome by molecular
            genetic analysis: a common mutation, R179X
  JOURNAL   J. Hum. Genet. 46 (5), 260-262 (2001)
   PUBMED   11355015
REFERENCE   9  (bases 1 to 4038)
  AUTHORS   Tsujino,S., Kanazawa,N., Ohashi,T., Eto,Y., Saito,T., Kira,J. and
            Yamada,T.
  TITLE     Three novel mutations (G27E, insAAC, R179X) in the ORNT1 gene of
            Japanese patients with hyperornithinemia, hyperammonemia, and
            homocitrullinuria syndrome
  JOURNAL   Ann. Neurol. 47 (5), 625-631 (2000)
   PUBMED   10805333
REFERENCE   10 (bases 1 to 4038)
  AUTHORS   Camacho,J.A., Obie,C., Biery,B., Goodman,B.K., Hu,C.A.,
            Almashanu,S., Steel,G., Casey,R., Lambert,M., Mitchell,G.A. and
            Valle,D.
  TITLE     Hyperornithinaemia-hyperammonaemia-homocitrullinuria syndrome is
            caused by mutations in a gene encoding a mitochondrial ornithine
            transporter
  JOURNAL   Nat. Genet. 22 (2), 151-158 (1999)
   PUBMED   10369256
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DB505424.1, BI461478.1,
            BC002702.2, BU726339.1, AL161614.16 and AA948095.1.
            This sequence is a reference standard in the RefSeqGene project.
            On May 15, 2009 this sequence version replaced gi:88703039.
            
            Summary: This gene is a member of the mitochondrial carrier family.
            The encoded protein transports ornithine across the inner
            mitochondrial membrane from the cytosol to the mitochondrial
            matrix. The protein is an essential component of the urea cycle,
            and functions in ammonium detoxification and biosynthesis of the
            amino acid arginine. Mutations in this gene result in
            hyperornithinemia-hyperammonemia-homocitrullinuria (HHH) syndrome.
            There is a pseudogene of this locus on the Y chromosome.[provided
            by RefSeq, May 2009].
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF112968.1, AF177333.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025085 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: reported by MitoCarta
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-48                DB505424.1         1-48
            49-86               BI461478.1         54-91
            87-1081             BC002702.2         1-995
            1082-1388           BU726339.1         18-324              c
            1389-3832           AL161614.16        55243-57686
            3833-4038           AA948095.1         1-206               c
FEATURES             Location/Qualifiers
     source          1..4038
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="13"
                     /map="13q14"
     gene            1..4038
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /note="solute carrier family 25 (mitochondrial carrier;
                     ornithine transporter) member 15"
                     /db_xref="GeneID:10166"
                     /db_xref="HGNC:10985"
                     /db_xref="HPRD:04838"
                     /db_xref="MIM:603861"
     exon            1..253
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    224..226
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /note="upstream in-frame stop codon"
     exon            254..377
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="alignment:Splign:1.39.8"
     CDS             323..1228
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /note="ornithine transporter 1; solute carrier family 25
                     member 15"
                     /codon_start=1
                     /product="mitochondrial ornithine transporter 1"
                     /protein_id="NP_055067.1"
                     /db_xref="GI:7657585"
                     /db_xref="CCDS:CCDS9373.1"
                     /db_xref="GeneID:10166"
                     /db_xref="HGNC:10985"
                     /db_xref="HPRD:04838"
                     /db_xref="MIM:603861"
                     /translation="
MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY
"
     misc_feature    335..397
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y619.1);
                     transmembrane region"
     misc_feature    341..595
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y619.1);
                     Region: Solcar 1"
     misc_feature    356..604
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     pfam00153"
                     /db_xref="CDD:201040"
     misc_feature    524..586
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y619.1);
                     transmembrane region"
     misc_feature    632..913
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y619.1);
                     Region: Solcar 2"
     misc_feature    650..712
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y619.1);
                     transmembrane region"
     misc_feature    <686..916
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     pfam00153"
                     /db_xref="CDD:201040"
     misc_feature    824..886
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y619.1);
                     transmembrane region"
     misc_feature    935..1210
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     pfam00153"
                     /db_xref="CDD:201040"
     misc_feature    941..1201
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y619.1);
                     Region: Solcar 3"
     misc_feature    941..1003
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y619.1);
                     transmembrane region"
     misc_feature    1031..1093
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y619.1);
                     transmembrane region"
     exon            378..636
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(439)
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:55943532"
     exon            637..774
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="alignment:Splign:1.39.8"
     exon            775..944
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="alignment:Splign:1.39.8"
     exon            945..1103
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="alignment:Splign:1.39.8"
     exon            1104..4021
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /inference="alignment:Splign:1.39.8"
     STS             1784..1959
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /standard_name="D1S1425"
                     /db_xref="UniSTS:149621"
     STS             1836..1954
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /standard_name="D10S16"
                     /db_xref="UniSTS:155756"
     STS             1981..2813
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /standard_name="GDB:631813"
                     /db_xref="UniSTS:158430"
     STS             2837..2951
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /standard_name="D10S16"
                     /db_xref="UniSTS:155756"
     STS             2843..2971
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /standard_name="D15S1477"
                     /db_xref="UniSTS:474482"
     STS             2857..2975
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /standard_name="D11S2560"
                     /db_xref="UniSTS:37928"
     STS             2876..2964
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /standard_name="D8S2279"
                     /db_xref="UniSTS:473907"
     STS             3270..3995
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /standard_name="SLC25A15_1851"
                     /db_xref="UniSTS:281014"
     STS             3708..3968
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
                     /standard_name="RH17529"
                     /db_xref="UniSTS:81574"
     polyA_signal    4018..4023
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
     polyA_site      4021
                     /gene="SLC25A15"
                     /gene_synonym="D13S327; HHH; ORC1; ORNT1"
ORIGIN      
tgggggcggtggcagggccggtgggcggtggcggctcccggtctcggctcgggcacggccctgggcaggccgcccgccagccgcaggggcgctcctgagcttcgcggggccgcagtccgggatgcctgcgcgaagggaggggcgaagggccggccgttgccgacgtgggtgttaagtggccgccccagccggcgacccggagccgagagcgggcggcggagcctgagctggacgcggccacgccggcgcggcgggatatgtggtgcctgtcataagctccagagagctgccttccacaagaccagcagaagagtgggcaaacatgaaatccaatcctgctatccaggctgccattgacctcacagcgggggctgcaggaggtacagcatgtgtactgaccgggcagccctttgacacaatgaaagtgaagatgcagacgttccctgacctgtaccggggcctcaccgactgctgcctgaagacttactcccaggtgggcttccgtggcttctacaagggtaccagtccagcactaatcgccaacatcgctgagaactcagtcctcttcatgtgctacggcttctgccagcaggtggtgcggaaagtggctggattggacaagcaggcaaagctgagtgatctgcagaatgcagccgccggttccttcgcctctgcctttgctgcactggtgctctgccccacggagctcgtgaagtgccggctgcagaccatgtatgagatggagacatcagggaagatagccaagagccagaatacagtgtggtctgtcatcaaaagtattcttaggaaagatggccccttggggttctaccatggactctcaagcactttacttcgagaagtaccaggctatttcttcttcttcggtggctatgaactgagccggtccttttttgcatcagggagatcaaaagatgaattaggccctgtacctttgatgttaagtggtggagttggtgggatttgcctctggcttgcggtatacccagtggattgtatcaaatccagaattcaagttctttccatgtctggaaaacaggcaggatttatcagaacctttataaatgttgtgaaaaatgaaggaataacggccttatattctggactgaaacctactatgattcgagcattccctgccaatggagcactctttttggcctacgaatatagcaggaagttgatgatgaaccagttggaagcatactgaagtgtcttggtgggcctgagccaagcacaggtgtttgaggactacagttcatctcagggtttcttggagtacaagaccagtgtgaagttattctgatttcttgggaattttgctttttgtcttcccttctaccctacatcttaaactttatggaagaacctctattttgcatcatatcatttctgtccataattgtactgaaatagaaaagtgaccgctcttgctcttggtaaaatatagagtggtcagtagccttatgcacctaattcaaaaggtggaatatagttctgtcagggcttttacgtaaacctccacttgtacatgcaatttggacagttatgtgttgagggaaatacagtttggtaccttgtttatttcaaatatcagaaaaacccagaggtgatcatttctcatgaagatgcttataaatggttgcttaacccattctagatgtagggtctgcttaatgtgtgtacttttctaagtggttgattattttttatttttttgatacagagtctcactctgtcacccagactggagtgcagtggcacgatctcggctcactgcaacctccgcctcctgggttcaagcgattctctcacctcagcctcctgagtagctgggattacaggtacgcgccaccatgtccagctaattttttttggtattttttgtagagacgaggtttcaccatgttgtccaggttggtctcgaactcctgacctcaagtgatccgcccacctcggcctcccaaagtgctgggattactggtgtgagccaccatgcccagccagtggttgaattttttaaaaagtgttcatggggtgcttgaaaactaaaatatccttctagatttgtaagacagtatacctgcatactggtgtggcttccacacttgagtaaaagcttcagagtaggtatcctagatttccccaagatgctctactcttaaaatagtgccattcattttctaggtgggatcatattccacgctgactatattgctaggggtggcccagagggtcaggcctttgggaaatagcatggcctttaccagcttcccttctctcccaaagaacttcccttcttgggctttagattgaggaaggggctgagtggtaggcggtgctgctgtgctctgatgaagacccatgtggctagcaacagcgcttaccttttgtctctgggtcctggcctggggccatcaatccactttgggccactcactgtctgctctgcctccaccaatcagaaacccttccaaggaacagtgagagccaaagccaagagaagccttcttccctgtttggtgattgtgtgacagtgggtgaacctctctcagagagaactagaaagaactcagtgcttgtactccacagtgagtaatgtcaggtctgacccatcctgaagcctgtcttgccatgcttttacagtgttggaggcttctacatttggtacttgcagtcagtaagtcttaatgatgactgtatatgtgatatgagtttataaagcaatggaacataagaaaagcaattgtaggccaggcgcagtggctcacgcctataatcccagcactttgggaggctgaggcgggcgggtcacaaggtcaggagttcgagaacagcctgaccaacatggtgaaaccccatctctactaaaaatacaaaaattagctgggcgtggtggcacgtgcctgtaatcccagctactcaggaggctgaggcaggagaatcgcttgaacccgggaggcagaggttgcagtgaactgagattgtgccactgcactccagactgggtgacacagcgagacttcatctcaaaaaaaaaaagaaaagaaaagcaattgtacttcactatgccatatgtatgtattcactgaccaaaaattcactgaccaaccaaccaaactccacacttcatctgatcccccatagacttggggatggacagctgttctttggccatatggtataagaggatcattcttgtcactacttaagttagcctcatcattttgtgctgctccaacaccagcagggtatctcccaataaagtgttcctaagcagcctgtatactgagtgcaagcaggctatcaattttaataatagtccataccatgtatgtgtttctgtcagcagaatgtacatgttgtacaaaacctccaggttccttaagctttttgctgtccatgaatcctctgtggcaactgtaatcacagagccagaagccagagggccagggatatgagaggctgacaaacatcaggggacatctggggaggagatccctgtcatgtctcttgtgccatggagctattatggctggtcttccatttgctttttctttaagtgaaaaccatttttctactttgcttttctctccatacttaaatggtcagtagctactgagtggtgctttatctgaataggcctggatcgaagtaaaatagaaatgggactggctttccacaggaagtaaactgcttcagagcccacagtcccctgctcagtgtccggaaagaagtcagtcatccctgttggcagtaaatcttcccacaggccgtccattagagatttaactagatatgttcaatagaaagagtctgaggcaagtggaaatgaggaacggaaacttaggttgggagaatattttttttttattcattctgtttgcttaattcagagtacagtttgtgctatttcatatctgtactccaggcagaaatataacttgaaaatactgtgtctaaagaaatttcagtgttctatcattaaattatttacttaataaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:10166 -> Molecular function: GO:0000064 [L-ornithine transmembrane transporter activity] evidence: TAS
            GeneID:10166 -> Biological process: GO:0000050 [urea cycle] evidence: TAS
            GeneID:10166 -> Biological process: GO:0000066 [mitochondrial ornithine transport] evidence: TAS
            GeneID:10166 -> Biological process: GO:0006520 [cellular amino acid metabolic process] evidence: TAS
            GeneID:10166 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS
            GeneID:10166 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
            GeneID:10166 -> Cellular component: GO:0005743 [mitochondrial inner membrane] evidence: TAS
            GeneID:10166 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.