Home |
Help |
Advanced search
2025-05-09 16:56:24, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_004447 4088 bp mRNA linear PRI 16-JUN-2013
DEFINITION Homo sapiens epidermal growth factor receptor pathway substrate 8
(EPS8), mRNA.
ACCESSION NM_004447
VERSION NM_004447.5 GI:215272356
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 4088)
AUTHORS Werner,A., Disanza,A., Reifenberger,N., Habeck,G., Becker,J.,
Calabrese,M., Urlaub,H., Lorenz,H., Schulman,B., Scita,G. and
Melchior,F.
TITLE SCFFbxw5 mediates transient degradation of actin remodeller Eps8 to
allow proper mitotic progression
JOURNAL Nat. Cell Biol. 15 (2), 179-188 (2013)
PUBMED 23314863
REMARK GeneRIF: Identify Fbxw5-driven fluctuation of Eps8 levels as an
important mechanism that contributes to cell-shape changes during
entry into-and exit from-mitosis.
REFERENCE 2 (bases 1 to 4088)
AUTHORS Ding,X., Zhou,F., Wang,F., Yang,Z., Zhou,C., Zhou,J., Zhang,B.,
Yang,J., Wang,G., Wei,Z., Hu,X., Xiang,S. and Zhang,J.
TITLE Eps8 promotes cellular growth of human malignant gliomas
JOURNAL Oncol. Rep. 29 (2), 697-703 (2013)
PUBMED 23229386
REMARK GeneRIF: We found that Eps8 mediates cell proliferation and
survival of glioma cells, at least in part, by affecting
phosphorylated ERK and Akt/beta-catenin activities.
REFERENCE 3 (bases 1 to 4088)
AUTHORS Cattaneo,M.G., Cappellini,E. and Vicentini,L.M.
TITLE Silencing of Eps8 blocks migration and invasion in human
glioblastoma cell lines
JOURNAL Exp. Cell Res. 318 (15), 1901-1912 (2012)
PUBMED 22683923
REMARK GeneRIF: silencing of the protein by siRNA abrogated the migratory
and invasive capacity of three different glioblastoma cell lines
both in 2-dimensional and 3-dimensional in vitro assays.
REFERENCE 4 (bases 1 to 4088)
AUTHORS Abdel-Rahman,W.M., Ruosaari,S., Knuutila,S. and Peltomaki,P.
TITLE Differential roles of EPS8 in carcinogenesis: loss of protein
expression in a subset of colorectal carcinoma and adenoma
JOURNAL World J. Gastroenterol. 18 (29), 3896-3903 (2012)
PUBMED 22876043
REMARK GeneRIF: The loss of EPS8 expression in colorectal adenomas and
carcinomas suggests that down regulation of this gene contributes
to the development of a subset of colorectal cancers.
REFERENCE 5 (bases 1 to 4088)
AUTHORS Chen,Y.J., Hsieh,M.Y., Chang,M.Y., Chen,H.C., Jan,M.S., Maa,M.C.
and Leu,T.H.
TITLE Eps8 protein facilitates phagocytosis by increasing TLR4-MyD88
protein interaction in lipopolysaccharide-stimulated macrophages
JOURNAL J. Biol. Chem. 287 (22), 18806-18819 (2012)
PUBMED 22493489
REMARK GeneRIF: Eps8 is a key regulator of the LPS-stimulated TLR4-MyD88
interaction and contributes to macrophage phagocytosis
REFERENCE 6 (bases 1 to 4088)
AUTHORS Avantaggiato,V., Torino,A., Wong,W.T., Di Fiore,P.P. and Simeone,A.
TITLE Expression of the receptor tyrosine kinase substrate genes eps8 and
eps15 during mouse development
JOURNAL Oncogene 11 (6), 1191-1198 (1995)
PUBMED 7566980
REFERENCE 7 (bases 1 to 4088)
AUTHORS Matoskova,B., Wong,W.T., Salcini,A.E., Pelicci,P.G. and Di
Fiore,P.P.
TITLE Constitutive phosphorylation of eps8 in tumor cell lines: relevance
to malignant transformation
JOURNAL Mol. Cell. Biol. 15 (7), 3805-3812 (1995)
PUBMED 7791787
REFERENCE 8 (bases 1 to 4088)
AUTHORS Karlsson,T., Songyang,Z., Landgren,E., Lavergne,C., Di Fiore,P.P.,
Anafi,M., Pawson,T., Cantley,L.C., Claesson-Welsh,L. and Welsh,M.
TITLE Molecular interactions of the Src homology 2 domain protein Shb
with phosphotyrosine residues, tyrosine kinase receptors and Src
homology 3 domain proteins
JOURNAL Oncogene 10 (8), 1475-1483 (1995)
PUBMED 7537362
REFERENCE 9 (bases 1 to 4088)
AUTHORS Castagnino,P., Biesova,Z., Wong,W.T., Fazioli,F., Gill,G.N. and Di
Fiore,P.P.
TITLE Direct binding of eps8 to the juxtamembrane domain of EGFR is
phosphotyrosine- and SH2-independent
JOURNAL Oncogene 10 (4), 723-729 (1995)
PUBMED 7532293
REFERENCE 10 (bases 1 to 4088)
AUTHORS Cardwell,C.
TITLE Student or worker? International Meeting of Student Nurses
(European Group)
JOURNAL Nurs Mirror Midwives J 143 (19), 38 (1976)
PUBMED 1049958
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AK304860.1, BC030010.2 and
AI377466.1.
On Nov 27, 2008 this sequence version replaced gi:56682952.
Summary: This gene encodes a member of the EPS8 family. This
protein contains one PH domain and one SH3 domain. It functions as
part of the EGFR pathway, though its exact role has not been
determined. Highly similar proteins in other organisms are involved
in the transduction of signals from Ras to Rac and growth
factor-mediated actin remodeling. Alternate transcriptional splice
variants of this gene have been observed but have not been
thoroughly characterized. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC030010.2, U12535.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-2463 AK304860.1 1-2463
2464-4062 BC030010.2 2276-3874
4063-4088 AI377466.1 1-26 c
FEATURES Location/Qualifiers
source 1..4088
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="12"
/map="12p12.3"
gene 1..4088
/gene="EPS8"
/note="epidermal growth factor receptor pathway substrate
8"
/db_xref="GeneID:2059"
/db_xref="HGNC:3420"
/db_xref="MIM:600206"
exon 1..416
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
exon 417..496
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
CDS 438..2906
/gene="EPS8"
/codon_start=1
/product="epidermal growth factor receptor kinase
substrate 8"
/protein_id="NP_004438.3"
/db_xref="GI:56682953"
/db_xref="CCDS:CCDS31753.1"
/db_xref="GeneID:2059"
/db_xref="HGNC:3420"
/db_xref="MIM:600206"
/translation="
MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVSDISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLESKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDIESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWAADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKRKKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQNPSAADLVHFLFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEWPKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADPPYTHTIQKQRMEYGPRPADTPPAPSPPPTPAPVPVPLPPSTPAPVPVSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVINITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQKAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
"
misc_feature order(624..647,744..764,771..791,837..851,879..893,
924..938)
/gene="EPS8"
/note="PH-like core; other site"
/db_xref="CDD:176275"
misc_feature 627..1019
/gene="EPS8"
/note="Phosphotyrosine-binding domain; Region: PTB;
pfam08416"
/db_xref="CDD:203936"
misc_feature 1863..1865
/gene="EPS8"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q12929.1); phosphorylation site"
misc_feature 2010..2012
/gene="EPS8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 2040..2201
/gene="EPS8"
/note="Src Homology 3 domain of Epidermal growth factor
receptor kinase substrate 8 and similar proteins; Region:
SH3_Eps8; cd11764"
/db_xref="CDD:212698"
misc_feature order(2040..2057,2061..2063,2070..2072,2079..2087,
2106..2123,2127..2153,2166..2177,2187..2201)
/gene="EPS8"
/note="swapped dimer interface [polypeptide binding];
other site"
/db_xref="CDD:212698"
misc_feature order(2061..2063,2073..2081,2130..2138,2142..2144,
2169..2174,2178..2189)
/gene="EPS8"
/note="peptide ligand binding site [polypeptide binding];
other site"
/db_xref="CDD:212698"
misc_feature 2382..2903
/gene="EPS8"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q12929.1);
Region: Effector region (By similarity)"
misc_feature 2421..2423
/gene="EPS8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 2427..2429
/gene="EPS8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 2475..2531
/gene="EPS8"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q12929.1);
Region: Amphipathic helix (By similarity)"
misc_feature 2589..2651
/gene="EPS8"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q12929.1);
Region: Helix bundle 1 (By similarity)"
misc_feature 2595..2789
/gene="EPS8"
/note="SAM domain of EPS8-like subfamily; Region:
SAM_EPS8-like; cd09540"
/db_xref="CDD:188939"
misc_feature 2691..2708
/gene="EPS8"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q12929.1);
Region: Helix bundle 2 (By similarity)"
misc_feature 2721..2738
/gene="EPS8"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q12929.1);
Region: Helix bundle 3 (By similarity)"
misc_feature 2733..2792
/gene="EPS8"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q12929.1);
Region: Helix bundle 4 (By similarity)"
misc_feature 2757..2759
/gene="EPS8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 2868..2870
/gene="EPS8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 2880..2882
/gene="EPS8"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
exon 497..573
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
exon 574..641
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
variation 634
/gene="EPS8"
/replace="a"
/replace="g"
/db_xref="dbSNP:77383735"
exon 642..803
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
variation 650
/gene="EPS8"
/replace="c"
/replace="t"
/db_xref="dbSNP:2230644"
exon 804..953
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
exon 954..1036
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
variation 954
/gene="EPS8"
/replace="g"
/replace="t"
/db_xref="dbSNP:78872942"
exon 1037..1173
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
exon 1174..1247
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
exon 1248..1374
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
variation 1312
/gene="EPS8"
/replace="a"
/replace="t"
/db_xref="dbSNP:76714646"
exon 1375..1463
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
variation 1377
/gene="EPS8"
/replace="a"
/replace="g"
/db_xref="dbSNP:79631530"
variation 1423
/gene="EPS8"
/replace="c"
/replace="t"
/db_xref="dbSNP:79739141"
exon 1464..1538
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
variation 1520
/gene="EPS8"
/replace="a"
/replace="g"
/db_xref="dbSNP:76040570"
exon 1539..1687
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
exon 1688..1871
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
exon 1872..2005
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
variation 1895
/gene="EPS8"
/replace="c"
/replace="t"
/db_xref="dbSNP:201971316"
variation 1919
/gene="EPS8"
/replace="c"
/replace="t"
/db_xref="dbSNP:75560906"
variation 1992
/gene="EPS8"
/replace="c"
/replace="t"
/db_xref="dbSNP:76688635"
exon 2006..2114
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
variation 2090
/gene="EPS8"
/replace="a"
/replace="g"
/db_xref="dbSNP:75362705"
exon 2115..2258
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
exon 2259..2481
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
variation 2275
/gene="EPS8"
/replace="a"
/replace="g"
/db_xref="dbSNP:74888964"
exon 2482..2662
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
variation 2550
/gene="EPS8"
/replace="a"
/replace="g"
/db_xref="dbSNP:78763451"
exon 2663..2792
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
variation 2667
/gene="EPS8"
/replace="a"
/replace="g"
/db_xref="dbSNP:77967764"
variation 2789
/gene="EPS8"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1126786"
exon 2793..4083
/gene="EPS8"
/inference="alignment:Splign:1.39.8"
variation 2853
/gene="EPS8"
/replace="g"
/replace="t"
/db_xref="dbSNP:1802658"
variation 2907
/gene="EPS8"
/replace="c"
/replace="t"
/db_xref="dbSNP:75484324"
variation 2920
/gene="EPS8"
/replace="a"
/replace="g"
/db_xref="dbSNP:74652091"
STS 3295..3628
/gene="EPS8"
/standard_name="SHGC-12935"
/db_xref="UniSTS:5607"
STS 3662..3836
/gene="EPS8"
/standard_name="RH70563"
/db_xref="UniSTS:38357"
STS 3726..4029
/gene="EPS8"
/standard_name="SHGC-132117"
/db_xref="UniSTS:170656"
variation 3737
/gene="EPS8"
/replace="a"
/replace="g"
/db_xref="dbSNP:8664"
polyA_signal 4037..4042
/gene="EPS8"
polyA_signal 4061..4066
/gene="EPS8"
polyA_site 4083
/gene="EPS8"
ORIGIN
cacttcgcctcaagcgctggagtcgaccagaactctgcggctcggctgccggcaagacccggatagcggatttcgctcctggctgcggggcgcgcactcgcccgcccgcccgctcgctcgttcctcgcgcgggcactgggcatgcgcggcgcgcggttggcactggctgcgagcgggcgggcggctccagacttcacaggcagcagctagcgaggcggtctcgcccggcgcgaggccggcgctgtgctcgcctcggagatcgctgctctttagctgggtgcagaaggcggctccgcggctcgcggacgactggctgggcgcgaatcagattggggggctttctcccggtcccctcccacctcgtctgggctcgcggcgtctccggggaaagccgtggccccgagggcggatccgagaacacacaagtgaaagacacaatgaatggtcatatttctaatcatcccagtagttttggaatgtacccatctcagatgaatggctacggatcatcacctaccttttcccagacggacagagaacatggttcaaaaacaagtgcaaaggccctttatgaacaaaggaagaattatgcacgggacagtgtcagcagtgtgtcagatatatctcaataccgtgttgaacacttgactacctttgtcctggatcggaaagatgctatgatcactgttgatgatggaataaggaaattgaaattgcttgatgccaagggcaaagtgtggactcaagatatgattcttcaagtggatgacagagctgtgagcctgattgatttagaatcaaagaatgaactggagaattttcctttaaacacaatccagcactgccaagctgtgatgcattcatgcagctatgattcagttcttgcactggtgtgcaaagagccaacccagaacaagccagatcttcatctcttccagtgtgatgaggttaaggcaaacctaattagtgaagatattgaaagtgcaatcagtgacagtaaaggagggaaacagaagaggcggcccgacgccctgaggatgatttccaatgcagaccctagtataccgcctccacccagagctcctgcccctgcgccccctgggaccgtcacccaggtggatgttagaagtcgagtggcagcctggtctgcatgggcagccgaccaaggggactttgagaaaccaaggcagtatcatgagcaggaagaaacacctgagatgatggcagcccgcattgacagagatgtgcaaatcttaaaccacattttggatgacattgaattttttatcacaaaactccaaaaagcagcagaagcattttctgagctttctaaaaggaagaaaaacaagaaaggtaaaaggaaaggaccaggagagggtgttttaacgctgcgggcaaaacctccacctcctgatgaatttcttgactgtttccaaaagtttaaacacggatttaaccttctggccaaactgaagtctcatattcagaatcctagtgctgcagatttggttcactttttgtttactccattaaatatggtggtgcaggcaacaggaggtcctgaactagccagttcagtacttagtcccctattgaataaggacacaattgatttcttaaattatactgtcaatggtgatgaacggcagctgtggatgtcattgggaggaacttggatgaaagccagagcagagtggccaaaagaacagtttattccaccatatgttccacgattccgcaatggctgggagcccccaatgctgaactttatgggagccacaatggaacaagatctttatcaactggcagaatctgtggcaaatgtagcagaacatcagcgcaaacaggaaataaaaagattatccacagagcattccagtgtatcagagtatcatccagccgatggctatgcgttcagtagcaacatttacacaagaggatcccacctggaccaaggggaagctgctgttgcttttaagccaacttctaatcgccatatagatagaaattatgaaccactcaaaacacaacccaagaaatatgccaaatccaagtatgactttgtagcaaggaacaacagtgagctctcggttctaaaggatgatattttagagatacttgatgatcggaagcaatggtggaaagttcgaaatgcaagtggagactctggatttgtgccaaataacattttggatattgtgagacctccagaatctggattggggcgtgctgatccaccttatactcatactatacagaaacaaaggatggagtatggcccaagaccagctgatactccccctgctccatcacctcctccaacaccagctcctgttcctgttccccttcccccttccactccagcacctgttcctgtgtcaaaggtcccagcaaatataacacgtcaaaacagcagctccagtgacagtggtggcagtatcgtgcgagacagccagagacacaaacaacttccggtggaccgaaggaaatctcagatggaggaagtgcaagatgaactcatccacagactgaccattggtcggagtgccgctcagaagaaattccatgtgccacggcagaacgtgccagttatcaatatcacttacgactccacaccagaggatgtgaagacgtggttacagtcaaagggattcaaccctgtgactgtcaatagtcttggagtattaaatggtgcacaacttttctctctcaataaggatgaactgaggacagtctgccctgaaggggcgagagtctatagccaaatcactgtacaaaaagctgcattggaggatagcagtggcagctccgagttacaagaaattatgagaagacgacaggaaaaaatcagtgctgccgctagtgattcaggagtggaatcttttgatgaaggaagcagtcactaatttgtttgtttgtatttaaactccattgtttttggcattattccaacatgctttgttttaagaagccttgaagggaatgtcagattcatttttcttgatgtaatttatcaccataaaaaaaaaacccatgcaaacctgagtgagcacaggatttgcttctaggcccattatttttattaaaactgaaaaaatttaaactgaattttttgaccttggaaaatatttttcttactttaccaaggtgaagtttccttaattagactaattattttatccccatcccagggtataaacaggaattgttttgatagtggtggagttattcactgcaacaaagcaacaatgttgtccatgattcaaaatctaagcagtttcgattttgcctgtgaatatggtgtctgtcattcagggcatagctcactgtaggctagcctctgcttacttaagtctcttctctgacatactcaatggaagaatatttagatttatttaaagttcttaatgccaacagtttaaaaaaaaattaaaacatttgaatgaactgtaaagtacagccataccttggacatgcaaatataaatctatggagcattctcaagacagtttgtcatggctctgttgattgcaactccttgtatagcttgtattttgatttagtttatattctgcttattatgtatactgtgttcttatatatgagaaagcacaaatgcgaaagaggtcatgtcttctcaaaatctagcaaaggaagtagtctgcattggtgtgcattacagtattttgcttaatgaaagcctcagttctgaatgttgatatgagtagttaaaaggaagtggggccattttatgtgtttatctgtgtcaagtatttctggtaataagaagcacttaatttacacatattttaatcctgtgaaagattccacatagagaaaagaaagatacctaaccttcaacaaatgttatttttggaaacacaatttttgtcattaaatgttatattatttcacatatataaaacagatgttatgtaagaatgttgtatattttaacataaatcatttagagaaattatctagattcattaattttcatagtgcctttttcacatgagtcagctggaaagtctgcaataaacagtatttgctgtctgttaataaatggtttctgtctcattaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:2059 -> Molecular function: GO:0003779 [actin binding] evidence: ISS
GeneID:2059 -> Molecular function: GO:0005070 [SH3/SH2 adaptor activity] evidence: TAS
GeneID:2059 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:2059 -> Molecular function: GO:0048365 [Rac GTPase binding] evidence: ISS
GeneID:2059 -> Biological process: GO:0007165 [signal transduction] evidence: TAS
GeneID:2059 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS
GeneID:2059 -> Biological process: GO:0008283 [cell proliferation] evidence: TAS
GeneID:2059 -> Biological process: GO:0008344 [adult locomotory behavior] evidence: IEA
GeneID:2059 -> Biological process: GO:0008360 [regulation of cell shape] evidence: ISS
GeneID:2059 -> Biological process: GO:0010458 [exit from mitosis] evidence: ISS
GeneID:2059 -> Biological process: GO:0016601 [Rac protein signal transduction] evidence: ISS
GeneID:2059 -> Biological process: GO:0030832 [regulation of actin filament length] evidence: ISS
GeneID:2059 -> Biological process: GO:0031532 [actin cytoskeleton reorganization] evidence: IEA
GeneID:2059 -> Biological process: GO:0036336 [dendritic cell migration] evidence: ISS
GeneID:2059 -> Biological process: GO:0048149 [behavioral response to ethanol] evidence: IEA
GeneID:2059 -> Biological process: GO:0051016 [barbed-end actin filament capping] evidence: ISS
GeneID:2059 -> Biological process: GO:0051017 [actin filament bundle assembly] evidence: ISS
GeneID:2059 -> Biological process: GO:0051764 [actin crosslink formation] evidence: ISS
GeneID:2059 -> Biological process: GO:0070358 [actin polymerization-dependent cell motility] evidence: ISS
GeneID:2059 -> Cellular component: GO:0005938 [cell cortex] evidence: ISS
GeneID:2059 -> Cellular component: GO:0014069 [postsynaptic density] evidence: IEA
GeneID:2059 -> Cellular component: GO:0017146 [N-methyl-D-aspartate selective glutamate receptor complex] evidence: IEA
GeneID:2059 -> Cellular component: GO:0030426 [growth cone] evidence: IEA
GeneID:2059 -> Cellular component: GO:0032420 [stereocilium] evidence: ISS
GeneID:2059 -> Cellular component: GO:0032587 [ruffle membrane] evidence: ISS
GeneID:2059 -> Cellular component: GO:0070062 [extracellular vesicular exosome] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.