GGRNA | NM_004057.2

LOCUS       NM_004057                453 bp    mRNA    linear   PRI 29-APR-2013
DEFINITION  Homo sapiens S100 calcium binding protein G (S100G), mRNA.
ACCESSION   NM_004057
VERSION     NM_004057.2  GI:112382245
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 453)
  AUTHORS   Fukushima,A., Aizaki,Y. and Sakuma,K.
  TITLE     Short-chain fatty acids increase the level of calbindin-D9k
            messenger RNA in Caco-2 cells
  JOURNAL   J. Nutr. Sci. Vitaminol. 58 (4), 287-291 (2012)
   PUBMED   23132313
  REMARK    GeneRIF: Addition of short-chain fatty acids to cultured Caco-2
            cells results in elevation of calbindin-D9k mRNA.
REFERENCE   2  (bases 1 to 453)
  AUTHORS   Halhali,A., Figueras,A.G., Diaz,L., Avila,E., Barrera,D.,
            Hernandez,G. and Larrea,F.
  TITLE     Effects of calcitriol on calbindins gene expression and lipid
            peroxidation in human placenta
  JOURNAL   J. Steroid Biochem. Mol. Biol. 121 (1-2), 448-451 (2010)
   PUBMED   20214988
  REMARK    GeneRIF: cultured syncytiotrophoblast cells express calbindin-D9k
            and calbindin-D28k genes, which are stimulated by calcitriol
REFERENCE   3  (bases 1 to 453)
  AUTHORS   Mao,X., Mao,Z. and Huo,Z.
  TITLE     [Effect of parathyroid hormone and 1,25-(OH)2-D3 on the expression
            of the mRNA of calbindin D9k in Caco-2 cells]
  JOURNAL   Wei Sheng Yan Jiu 36 (3), 372-375 (2007)
   PUBMED   17712966
  REMARK    GeneRIF: Parathyroid hormone may inhibit or counteract the increase
            in CaBP-D9k mRNA caused by 1,25-(OH)2-D3 in Caco-2 cells.
REFERENCE   4  (bases 1 to 453)
  AUTHORS   Ross,M.T., Grafham,D.V., Coffey,A.J., Scherer,S., McLay,K.,
            Muzny,D., Platzer,M., Howell,G.R., Burrows,C., Bird,C.P.,
            Frankish,A., Lovell,F.L., Howe,K.L., Ashurst,J.L., Fulton,R.S.,
            Sudbrak,R., Wen,G., Jones,M.C., Hurles,M.E., Andrews,T.D.,
            Scott,C.E., Searle,S., Ramser,J., Whittaker,A., Deadman,R.,
            Carter,N.P., Hunt,S.E., Chen,R., Cree,A., Gunaratne,P., Havlak,P.,
            Hodgson,A., Metzker,M.L., Richards,S., Scott,G., Steffen,D.,
            Sodergren,E., Wheeler,D.A., Worley,K.C., Ainscough,R.,
            Ambrose,K.D., Ansari-Lari,M.A., Aradhya,S., Ashwell,R.I.,
            Babbage,A.K., Bagguley,C.L., Ballabio,A., Banerjee,R., Barker,G.E.,
            Barlow,K.F., Barrett,I.P., Bates,K.N., Beare,D.M., Beasley,H.,
            Beasley,O., Beck,A., Bethel,G., Blechschmidt,K., Brady,N.,
            Bray-Allen,S., Bridgeman,A.M., Brown,A.J., Brown,M.J., Bonnin,D.,
            Bruford,E.A., Buhay,C., Burch,P., Burford,D., Burgess,J.,
            Burrill,W., Burton,J., Bye,J.M., Carder,C., Carrel,L., Chako,J.,
            Chapman,J.C., Chavez,D., Chen,E., Chen,G., Chen,Y., Chen,Z.,
            Chinault,C., Ciccodicola,A., Clark,S.Y., Clarke,G., Clee,C.M.,
            Clegg,S., Clerc-Blankenburg,K., Clifford,K., Cobley,V., Cole,C.G.,
            Conquer,J.S., Corby,N., Connor,R.E., David,R., Davies,J., Davis,C.,
            Davis,J., Delgado,O., Deshazo,D., Dhami,P., Ding,Y., Dinh,H.,
            Dodsworth,S., Draper,H., Dugan-Rocha,S., Dunham,A., Dunn,M.,
            Durbin,K.J., Dutta,I., Eades,T., Ellwood,M., Emery-Cohen,A.,
            Errington,H., Evans,K.L., Faulkner,L., Francis,F., Frankland,J.,
            Fraser,A.E., Galgoczy,P., Gilbert,J., Gill,R., Glockner,G.,
            Gregory,S.G., Gribble,S., Griffiths,C., Grocock,R., Gu,Y.,
            Gwilliam,R., Hamilton,C., Hart,E.A., Hawes,A., Heath,P.D.,
            Heitmann,K., Hennig,S., Hernandez,J., Hinzmann,B., Ho,S., Hoffs,M.,
            Howden,P.J., Huckle,E.J., Hume,J., Hunt,P.J., Hunt,A.R.,
            Isherwood,J., Jacob,L., Johnson,D., Jones,S., de Jong,P.J.,
            Joseph,S.S., Keenan,S., Kelly,S., Kershaw,J.K., Khan,Z.,
            Kioschis,P., Klages,S., Knights,A.J., Kosiura,A., Kovar-Smith,C.,
            Laird,G.K., Langford,C., Lawlor,S., Leversha,M., Lewis,L., Liu,W.,
            Lloyd,C., Lloyd,D.M., Loulseged,H., Loveland,J.E., Lovell,J.D.,
            Lozado,R., Lu,J., Lyne,R., Ma,J., Maheshwari,M., Matthews,L.H.,
            McDowall,J., McLaren,S., McMurray,A., Meidl,P., Meitinger,T.,
            Milne,S., Miner,G., Mistry,S.L., Morgan,M., Morris,S., Muller,I.,
            Mullikin,J.C., Nguyen,N., Nordsiek,G., Nyakatura,G., O'Dell,C.N.,
            Okwuonu,G., Palmer,S., Pandian,R., Parker,D., Parrish,J.,
            Pasternak,S., Patel,D., Pearce,A.V., Pearson,D.M., Pelan,S.E.,
            Perez,L., Porter,K.M., Ramsey,Y., Reichwald,K., Rhodes,S.,
            Ridler,K.A., Schlessinger,D., Schueler,M.G., Sehra,H.K.,
            Shaw-Smith,C., Shen,H., Sheridan,E.M., Shownkeen,R., Skuce,C.D.,
            Smith,M.L., Sotheran,E.C., Steingruber,H.E., Steward,C.A.,
            Storey,R., Swann,R.M., Swarbreck,D., Tabor,P.E., Taudien,S.,
            Taylor,T., Teague,B., Thomas,K., Thorpe,A., Timms,K., Tracey,A.,
            Trevanion,S., Tromans,A.C., d'Urso,M., Verduzco,D., Villasana,D.,
            Waldron,L., Wall,M., Wang,Q., Warren,J., Warry,G.L., Wei,X.,
            West,A., Whitehead,S.L., Whiteley,M.N., Wilkinson,J.E.,
            Willey,D.L., Williams,G., Williams,L., Williamson,A.,
            Williamson,H., Wilming,L., Woodmansey,R.L., Wray,P.W., Yen,J.,
            Zhang,J., Zhou,J., Zoghbi,H., Zorilla,S., Buck,D., Reinhardt,R.,
            Poustka,A., Rosenthal,A., Lehrach,H., Meindl,A., Minx,P.J.,
            Hillier,L.W., Willard,H.F., Wilson,R.K., Waterston,R.H., Rice,C.M.,
            Vaudin,M., Coulson,A., Nelson,D.L., Weinstock,G., Sulston,J.E.,
            Durbin,R., Hubbard,T., Gibbs,R.A., Beck,S., Rogers,J. and
            Bentley,D.R.
  TITLE     The DNA sequence of the human X chromosome
  JOURNAL   Nature 434 (7031), 325-337 (2005)
   PUBMED   15772651
REFERENCE   5  (bases 1 to 453)
  AUTHORS   Wang,L., Klopot,A., Freund,J.N., Dowling,L.N., Krasinski,S.D. and
            Fleet,J.C.
  TITLE     Control of differentiation-induced calbindin-D9k gene expression in
            Caco-2 cells by cdx-2 and HNF-1alpha
  JOURNAL   Am. J. Physiol. Gastrointest. Liver Physiol. 287 (5), G943-G953
            (2004)
   PUBMED   15217781
  REMARK    GeneRIF: Cdx-2 is a permissive factor that influences basal CaBP
            expression in enterocytes and that HNF-1alpha modulates CaBP gene
            expression during cellular differentiation.
REFERENCE   6  (bases 1 to 453)
  AUTHORS   Fleet,J.C. and Hock,J.M.
  TITLE     Identification of osteocalcin mRNA in nonosteoid tissue of rats and
            humans by reverse transcription-polymerase chain reaction
  JOURNAL   J. Bone Miner. Res. 9 (10), 1565-1573 (1994)
   PUBMED   7817802
REFERENCE   7  (bases 1 to 453)
  AUTHORS   Miller,E.K., Word,R.A., Goodall,C.A. and Iacopino,A.M.
  TITLE     Calbindin-D9K gene expression in human myometrium during pregnancy
            and labor
  JOURNAL   J. Clin. Endocrinol. Metab. 79 (2), 609-615 (1994)
   PUBMED   8045984
REFERENCE   8  (bases 1 to 453)
  AUTHORS   Jeung,E.B., Krisinger,J., Dann,J.L. and Leung,P.C.
  TITLE     Molecular cloning of the full-length cDNA encoding the human
            calbindin-D9k
  JOURNAL   FEBS Lett. 307 (2), 224-228 (1992)
   PUBMED   1379540
REFERENCE   9  (bases 1 to 453)
  AUTHORS   Howard,A., Legon,S., Spurr,N.K. and Walters,J.R.
  TITLE     Molecular cloning and chromosomal assignment of human calbindin-D9k
  JOURNAL   Biochem. Biophys. Res. Commun. 185 (2), 663-669 (1992)
   PUBMED   1610358
REFERENCE   10 (bases 1 to 453)
  AUTHORS   Balmain,N.
  TITLE     Calbindin-D9k. A vitamin-D-dependent, calcium-binding protein in
            mineralized tissues
  JOURNAL   Clin. Orthop. Relat. Res. 265, 265-276 (1991)
   PUBMED   2009668
  REMARK    Review article
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from L13220.1.
            On Aug 16, 2006 this sequence version replaced gi:4757897.
            
            Summary: This gene encodes calbindin D9K, a vitamin D-dependent
            calcium-binding protein. This cytosolic protein belongs to a family
            of calcium-binding proteins that includes calmodulin, parvalbumin,
            troponin C, and S100 protein. In the intestine, the protein is
            vitamin D-dependent and its expression correlates with calcium
            transport activity. The protein may increase Ca2+ absorption by
            buffering Ca2+ in the cytoplasm and increase ATP-dependent Ca2+
            transport in duodenal basolateral membrane vesicles. [provided by
            RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: L13220.1, BC112174.1 [ECO:0000332]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-453               L13220.1           4-456
FEATURES             Location/Qualifiers
     source          1..453
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="X"
                     /map="Xp22.2"
     gene            1..453
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /note="S100 calcium binding protein G"
                     /db_xref="GeneID:795"
                     /db_xref="HGNC:1436"
                     /db_xref="HPRD:02360"
                     /db_xref="MIM:302020"
     exon            1..46
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /inference="alignment:Splign:1.39.8"
     variation       15
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184900887"
     STS             35..343
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /db_xref="UniSTS:483420"
     exon            47..189
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /inference="alignment:Splign:1.39.8"
     variation       48
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41311513"
     CDS             55..294
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /note="calbindin D9K; calbindin-D9K; calbindin 3, (vitamin
                     D-dependent calcium-binding protein); S100 calcium-binding
                     protein G; vitamin D-dependent calcium-binding protein,
                     intestinal"
                     /codon_start=1
                     /product="protein S100-G"
                     /protein_id="NP_004048.1"
                     /db_xref="GI:4757898"
                     /db_xref="CCDS:CCDS14176.1"
                     /db_xref="GeneID:795"
                     /db_xref="HGNC:1436"
                     /db_xref="HPRD:02360"
                     /db_xref="MIM:302020"
                     /translation="

MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ

"
     misc_feature    67..291
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /note="S-100: S-100 domain, which represents the largest
                     family within the superfamily of proteins carrying the
                     Ca-binding EF-hand motif. Note that this S-100 hierarchy
                     contains only S-100 EF-hand domains, other EF-hands have
                     been modeled separately. S100...; Region: S-100; cd00213"
                     /db_xref="CDD:88292"
     misc_feature    order(67..108,124..132,157..162,166..174,247..258,
                     262..267,271..282,286..291)
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:88292"
     misc_feature    order(106..108,121..123,130..132,145..150,226..228,
                     232..234,238..240,244..246,250..252,259..261)
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:88292"
     misc_feature    127..282
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /note="EF-hand domain pair; Region: EF_hand_6; pfam13833"
                     /db_xref="CDD:206004"
     variation       62
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369636673"
     variation       136
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:192512496"
     exon            190..453
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /inference="alignment:Splign:1.39.8"
     variation       190
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200041601"
     STS             221..383
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /standard_name="GDB:604580"
                     /db_xref="UniSTS:98889"
     variation       256
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199885083"
     variation       260
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:145104796"
     variation       264
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375477819"
     variation       296
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186822909"
     variation       297
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144139570"
     STS             307..416
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /standard_name="RH1707"
                     /db_xref="UniSTS:5495"
     variation       335
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201526472"
     variation       337
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6629164"
     polyA_signal    433..438
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
     polyA_site      453
                     /gene="S100G"
                     /gene_synonym="CABP; CABP1; CABP9K; CALB3"
ORIGIN

aaactcctctttgattcttctagctgtttcactattgggcaaccagacaccagaatgagtactaaaaagtctcctgaggaactgaagaggatttttgaaaaatatgcagccaaagaaggtgatccagaccagttgtcaaaggatgaactgaagctattgattcaggctgaattccccagtttactcaaaggtccaaacaccctagatgatctctttcaagaactggacaagaatggagatggagaagttagttttgaagaattccaagtattagtaaaaaagatatcccagtgaaggagaaaacaaaatagaaccctgagcactggaggaagagcgcctgtgctgtggtcttatcctatgtggaatcccccaaagtctctggtttaattctttgcaattataataacctggctgtgaggttcagttattattaataaagaaattattagacat

//

Annotations: