GGRNA Home | Help | Advanced search

2025-10-27 03:24:37, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_003480               2900 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens microfibrillar associated protein 5 (MFAP5), mRNA.
ACCESSION   NM_003480
VERSION     NM_003480.2  GI:46359073
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2900)
  AUTHORS   Turkyilmaz,E., Guner,H., Erdem,M., Erdem,A., Biri,A.A., Konac,E.,
            Alp,E., Onen,H.I. and Menevse,S.
  TITLE     NLF2 gene expression in the endometrium of patients with
            implantation failure after IVF treatment
  JOURNAL   Gene 508 (1), 140-143 (2012)
   PUBMED   22885067
  REMARK    GeneRIF: Decreased MFAP5 gene expression in the endometrium of
            patients with implantation failure after in vitro ertilization
            treatment
REFERENCE   2  (bases 1 to 2900)
  AUTHORS   Rapko,S., Zhang,M., Richards,B., Hutto,E., Dethlefsen,S. and
            Duguay,S.
  TITLE     Identification of the chondrocyte lineage using
            microfibril-associated glycoprotein-2, a novel marker that
            distinguishes chondrocytes from synovial cells
  JOURNAL   Tissue Eng Part C Methods 16 (6), 1367-1375 (2010)
   PUBMED   20345228
  REMARK    GeneRIF: The MAGP2-based assay provided superior performance for
            the purpose of cell culture identification compared to assays using
            standard reference genes.
REFERENCE   3  (bases 1 to 2900)
  AUTHORS   Mok,S.C., Bonome,T., Vathipadiekal,V., Bell,A., Johnson,M.E.,
            Wong,K.K., Park,D.C., Hao,K., Yip,D.K., Donninger,H., Ozbun,L.,
            Samimi,G., Brady,J., Randonovich,M., Pise-Masison,C.A.,
            Barrett,J.C., Wong,W.H., Welch,W.R., Berkowitz,R.S. and Birrer,M.J.
  TITLE     A gene signature predictive for outcome in advanced ovarian cancer
            identifies a survival factor: microfibril-associated glycoprotein 2
  JOURNAL   Cancer Cell 16 (6), 521-532 (2009)
   PUBMED   19962670
  REMARK    GeneRIF: Independent evaluation confirmed the association of a
            prognostic gene microfibril-associated glycoprotein 2 (MAGP2) with
            poor prognosis in advanced ovarian cancer
REFERENCE   4  (bases 1 to 2900)
  AUTHORS   Albig,A.R., Becenti,D.J., Roy,T.G. and Schiemann,W.P.
  TITLE     Microfibril-associate glycoprotein-2 (MAGP-2) promotes angiogenic
            cell sprouting by blocking notch signaling in endothelial cells
  JOURNAL   Microvasc. Res. 76 (1), 7-14 (2008)
   PUBMED   18417156
  REMARK    GeneRIF: MAGP-2 promotes angiogenic cell spouting in vitro by
            antagonizing Notch signaling pathways in endothelial cells.
REFERENCE   5  (bases 1 to 2900)
  AUTHORS   Miyamoto,A., Lau,R., Hein,P.W., Shipley,J.M. and Weinmaster,G.
  TITLE     Microfibrillar proteins MAGP-1 and MAGP-2 induce Notch1
            extracellular domain dissociation and receptor activation
  JOURNAL   J. Biol. Chem. 281 (15), 10089-10097 (2006)
   PUBMED   16492672
  REMARK    GeneRIF: microfibrillar proteins MAGP-1 and MAGP-2 can function
            outside of their role in elastic fibers to activate a cellular
            signaling pathway
REFERENCE   6  (bases 1 to 2900)
  AUTHORS   Imabayashi,H., Mori,T., Gojo,S., Kiyono,T., Sugiyama,T., Irie,R.,
            Isogai,T., Hata,J., Toyama,Y. and Umezawa,A.
  TITLE     Redifferentiation of dedifferentiated chondrocytes and
            chondrogenesis of human bone marrow stromal cells via chondrosphere
            formation with expression profiling by large-scale cDNA analysis
  JOURNAL   Exp. Cell Res. 288 (1), 35-50 (2003)
   PUBMED   12878157
REFERENCE   7  (bases 1 to 2900)
  AUTHORS   Penner,A.S., Rock,M.J., Kielty,C.M. and Shipley,J.M.
  TITLE     Microfibril-associated glycoprotein-2 interacts with fibrillin-1
            and fibrillin-2 suggesting a role for MAGP-2 in elastic fiber
            assembly
  JOURNAL   J. Biol. Chem. 277 (38), 35044-35049 (2002)
   PUBMED   12122015
REFERENCE   8  (bases 1 to 2900)
  AUTHORS   Hatzinikolas,G. and Gibson,M.A.
  TITLE     The exon structure of the human MAGP-2 gene. Similarity with the
            MAGP-1 gene is confined to two exons encoding a cysteine-rich
            region
  JOURNAL   J. Biol. Chem. 273 (45), 29309-29314 (1998)
   PUBMED   9792630
REFERENCE   9  (bases 1 to 2900)
  AUTHORS   Gibson,M.A., Hatzinikolas,G., Kumaratilake,J.S., Sandberg,L.B.,
            Nicholl,J.K., Sutherland,G.R. and Cleary,E.G.
  TITLE     Further characterization of proteins associated with elastic fiber
            microfibrils including the molecular cloning of MAGP-2 (MP25)
  JOURNAL   J. Biol. Chem. 271 (2), 1096-1103 (1996)
   PUBMED   8557636
  REMARK    Erratum:[J Biol Chem 1996 Mar 1;271(9):5288]
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AK124368.1, AU280458.1,
            U37283.1, AL833019.1 and BM678444.1.
            On Apr 12, 2004 this sequence version replaced gi:4505088.
            
            Summary: This gene encodes a 25-kD microfibril-associated
            glycoprotein which is rich in serine and threonine residues. It
            lacks a hydrophobic carboxyl terminus and proline-, glutamine-, and
            tyrosine-rich regions, which are characteristics of a related
            31-kDa microfibril-associated glycoprotein (MFAP2). The close
            similarity between these two proteins is confined to a central
            region of 60 aa where precise alignment of 7 cysteine residues
            occurs. The structural differences suggest that this encoded
            protein has some functions that are distinct from those of MFAP2.
            [provided by RefSeq, Jul 2008].
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK315807.1, BX398565.2 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-62                AK124368.1         48-109
            63-74               AU280458.1         52-63
            75-938              U37283.1           48-911
            939-1935            AK124368.1         911-1907
            1936-2836           AL833019.1         636-1536
            2837-2900           BM678444.1         1-64                c
FEATURES             Location/Qualifiers
     source          1..2900
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12p13.1-p12.3"
     gene            1..2900
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /note="microfibrillar associated protein 5"
                     /db_xref="GeneID:8076"
                     /db_xref="HGNC:29673"
                     /db_xref="HPRD:03063"
                     /db_xref="MIM:601103"
     exon            1..211
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /inference="alignment:Splign:1.39.8"
     variation       147
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28372697"
     misc_feature    148..150
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /note="upstream in-frame stop codon"
     exon            212..271
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /inference="alignment:Splign:1.39.8"
     CDS             214..735
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /note="microfibril-associated glycoprotein-2;
                     microfibrillar-associated protein 5;
                     microfibril-associated glycoprotein 2; MAGP-2; MFAP-5"
                     /codon_start=1
                     /product="microfibrillar-associated protein 5 precursor"
                     /protein_id="NP_003471.1"
                     /db_xref="GI:4505089"
                     /db_xref="CCDS:CCDS8595.1"
                     /db_xref="GeneID:8076"
                     /db_xref="HGNC:29673"
                     /db_xref="HPRD:03063"
                     /db_xref="MIM:601103"
                     /translation="
MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
"
     sig_peptide     214..297
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    217..627
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /note="Microfibril-associated glycoprotein (MAGP); Region:
                     MAGP; pfam05507"
                     /db_xref="CDD:114240"
     misc_feature    301..309
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q13361.1);
                     Region: Cell attachment site (Potential)"
     variation       249
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1802863"
     exon            272..307
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /inference="alignment:Splign:1.39.8"
     exon            308..352
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /inference="alignment:Splign:1.39.8"
     exon            353..385
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /inference="alignment:Splign:1.39.8"
     exon            386..430
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /inference="alignment:Splign:1.39.8"
     exon            431..460
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /inference="alignment:Splign:1.39.8"
     exon            461..548
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /inference="alignment:Splign:1.39.8"
     exon            549..622
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /inference="alignment:Splign:1.39.8"
     exon            623..2882
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /inference="alignment:Splign:1.39.8"
     STS             793..893
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /standard_name="WI-17490"
                     /db_xref="UniSTS:82486"
     variation       856
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:14541"
     STS             1177..1398
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /standard_name="SHGC-58129"
                     /db_xref="UniSTS:57233"
     STS             1429..1550
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /standard_name="RH99231"
                     /db_xref="UniSTS:92005"
     variation       1922
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11544165"
     STS             2000..2088
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /standard_name="D8S2279"
                     /db_xref="UniSTS:473907"
     STS             2050..2119
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /standard_name="D1S1423"
                     /db_xref="UniSTS:149619"
     STS             2581..2797
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /standard_name="STS-W94200"
                     /db_xref="UniSTS:6612"
     STS             2734..2809
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /standard_name="SHGC-36539"
                     /db_xref="UniSTS:8198"
     polyA_signal    2819..2824
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
     polyA_site      2836
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
     polyA_signal    2860..2865
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
     polyA_site      2882
                     /gene="MFAP5"
                     /gene_synonym="MAGP2; MP25"
                     /experiment="experimental evidence, no additional details
                     recorded"
ORIGIN      
attccagcctcattgtaacacacattctacgcctagcctggctttcttgctctccctcatctcattgtttcagcggaggccaaatctgaagtcctttccagggagtggctctgttcatcttattcgccagccaaagtaggaacagcgtaagaggagagagacacattcagcagccaaaggactcggtggaaagagcagaacaccatagacaatatgtcgctcttgggacccaaggtgctgctgtttcttgctgcattcatcatcacctctgactggatacccctgggggtcaatagtcaacgaggagacgatgtgactcaagcgactccagaaacattcacagaagatcctaatctggtgaatgatcccgctacagatgaaacagttttggctgttttggctgatattgcaccttccacagatgacttggcctccctcagtgaaaaaaataccactgcagagtgctgggatgagaaatttacctgcacaaggctctactctgtgcatcggccggttaaacaatgcattcatcagttatgcttcaccagtttacgacgtatgtacatcgtcaacaaggagatctgctctcgtcttgtctgtaaggaacacgaagctatgaaagatgagctttgccgtcagatggctggtctgccccctaggagactccgtcgctccaattacttccgacttcctccctgtgaaaatgtggatttgcagagacccaatggtctgtgatcattgaaaaagaggaaagaagaaaaaatgtatgggtgagaggaaggaggatctccttcttctccaaccattgacagctaacccttagacagtatttcttaaaccaatccttttgcaatgtccagcttttacccctactctctactttttcacccaaactgataacatttatctcattttctagcacttaaaatacaaagtctatattattgcataattttgctgcttctcaatatcatagacacagtgaatagatgatgactatatggcttatatacaaacattctatgtacaatttcaagggagactaaactttaggctaataatctttactattgaatctgtctgatatagatcttagggttgaagaagctatctttgtctatttgggctaaccatagaatttcatttattttcctcacaatattttcctagaccaactccccatcattcacgtgttcctctttactcttactttaactattttgctggcttgcccgaaaatttgcctggcaagtcttccttataagacacatcatggtaagttttgtagtcctgtaagattctgcaacacagtcaagaattatacaatcctactagcaatatataaggacccaaaatgtcttctgctaagctcagaggctggggctaaagcatgaggactatgccagctatagaacttggactcataattcgctatccaatttttcatgcagttgtctagtcgggaagtaaggttggaaactaagtctcatttactgattcgtttatgggtagtaccgggatgaacccaccaccacaaagcaaattagacaacttaatgtgaaatcataccattggttgacgtttccttgagttgctacttcgttcatcttcacaacttaacaagtgcacggtcgaattattgtgcaagtggcttttggatatcctgattggggcctaagaagggcattcagacttgaattttaataggcagacagaaagtttgcctaatagttaatacgaaagagtgaaagaaacacaatattcagacaacccacattcttatcctggctctagcagtaaccacgtagccttggataagccattttccttcattaggtcctggtttaatttcctcatctttaaaatgagaaggttaaatttatcttagtactgctgggcgcagtggctcatgcctgtaatctgagcactttgggaagctgaggcgggtggatcacttgaggtcagaaatttgagacgagcctggccaacatggtgaaaccccatctctactaaaaatacaaaaattagctgggcgtggtggcacgtgcctgtaatcccagctactcgggaggctgaggcaggagaatcaattgaacctgggaggcagaggttgcagtgagccgagatggcgccattgcactccagcctgggtgacaaaagcaaaagtccatcttaagaaatatatatatatattatatatattcttagttctaagatttcctttaattctatgattctctggatttaaatgcattattcatatttcttgaagcttagatacagtctaattcatagcaaccatatctgctttatcctaggtgagggtagcagtccacaatggaatagaagaaaatcccattataacaaatgacaaattatatatcatgaatccttctgtctgactaactcaataactttctataaaagccaatggaattcaaataggagctaggagacaacaagttatatatgacagtggaggttgtattccttttatattgctgagaaaactagttaaatgatcagattcttgctgttaagaaacaatttcgtttaatgggatctgtacaactgattttaaaaaaatgctacaaaaagccccaaagcatataatctctactccttacagtctctagaattaaatgtactcatttagacaacatattaaatgcatattttagccactttagagaaacctcataggcacagagtttccaagattaattttaagaatatcttcacgaacttgaccctcctactccacattgcaacatttccatcagacagcatttcaattccagtattatgtatattgcaaattaaacattttaaaatatttttttccaatttatttctcaaaataaaatgtcttttgttctggtaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:8076 -> Molecular function: GO:0005201 [extracellular matrix structural constituent] evidence: TAS
            GeneID:8076 -> Biological process: GO:0030198 [extracellular matrix organization] evidence: TAS
            GeneID:8076 -> Biological process: GO:0043206 [extracellular fibril organization] evidence: IEA
            GeneID:8076 -> Cellular component: GO:0001527 [microfibril] evidence: IEA
            GeneID:8076 -> Cellular component: GO:0005576 [extracellular region] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.