Home |
Help |
Advanced search
2025-11-09 17:40:53, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_001082619 1263 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens PIH1 domain containing 2 (PIH1D2), transcript variant
2, mRNA.
ACCESSION NM_001082619
VERSION NM_001082619.1 GI:130499471
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1263)
AUTHORS Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
Dunham,I., Hill,D.E. and Vidal,M.
TITLE hORFeome v3.1: a resource of human open reading frames representing
over 10,000 human genes
JOURNAL Genomics 89 (3), 307-315 (2007)
PUBMED 17207965
REFERENCE 2 (bases 1 to 1263)
AUTHORS Wang,A.G., Yoon,S.Y., Oh,J.H., Jeon,Y.J., Kim,M., Kim,J.M.,
Byun,S.S., Yang,J.O., Kim,J.H., Kim,D.G., Yeom,Y.I., Yoo,H.S.,
Kim,Y.S. and Kim,N.S.
TITLE Identification of intrahepatic cholangiocarcinoma related genes by
comparison with normal liver tissues using expressed sequence tags
JOURNAL Biochem. Biophys. Res. Commun. 345 (3), 1022-1032 (2006)
PUBMED 16712791
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
CB159963.1, AP000907.6 and CA312666.1.
Transcript Variant: This variant (2) uses an alternate 3'-terminal
exon, compared to variant 1, which results in a protein (isoform 2)
with a shorter and distinct C-terminus, compared to isoform 1.
##Evidence-Data-START##
RNAseq introns :: single sample supports all introns ERS025084,
ERS025085 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-544 CB159963.1 1-544
545-710 AP000907.6 172715-172880 c
711-1263 CA312666.1 1-553 c
FEATURES Location/Qualifiers
source 1..1263
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="11"
/map="11q23.1"
gene 1..1263
/gene="PIH1D2"
/note="PIH1 domain containing 2"
/db_xref="GeneID:120379"
/db_xref="HGNC:25210"
exon 1..192
/gene="PIH1D2"
/inference="alignment:Splign:1.39.8"
variation 127
/gene="PIH1D2"
/replace="a"
/replace="t"
/db_xref="dbSNP:4091707"
exon 193..400
/gene="PIH1D2"
/inference="alignment:Splign:1.39.8"
misc_feature 218..220
/gene="PIH1D2"
/note="upstream in-frame stop codon"
CDS 224..1090
/gene="PIH1D2"
/note="isoform 2 is encoded by transcript variant 2; PIH1
domain-containing protein 2"
/codon_start=1
/product="PIH1 domain-containing protein 2 isoform 2"
/protein_id="NP_001076088.1"
/db_xref="GI:130499472"
/db_xref="CCDS:CCDS44730.1"
/db_xref="GeneID:120379"
/db_xref="HGNC:25210"
/translation="
METSSKGLLTQVTQFWNLLDDLAQSDPEGYEKFIQQQLKEGKQLCAAPEPQLCLQTRILKPKEKILFINLCQWTRIPAPQSTTHPVPLTVGKPEDTTEISDAYTVIDVAYNPDVLHAAEKDQVKKNQLIQMAMKCIEEKFQFTLSHSYHITKFRIKGSIQRMKQNLMGIQTDSIDLREKMRRELTLGQIRSSTMSNPDHFPQLLLPKDQVSGKAVCLIEEISSTEIQVEMKMPAYELKIVHDHSEKPLKIELKVELPGINSVSLCDLSVSEGTTEPQALAKDELSLKF
"
misc_feature 278..1036
/gene="PIH1D2"
/note="pre-RNA processing PIH1/Nop17; Region: PIH1;
pfam08190"
/db_xref="CDD:203872"
exon 401..524
/gene="PIH1D2"
/inference="alignment:Splign:1.39.8"
exon 525..770
/gene="PIH1D2"
/inference="alignment:Splign:1.39.8"
exon 771..1036
/gene="PIH1D2"
/inference="alignment:Splign:1.39.8"
exon 1037..1248
/gene="PIH1D2"
/inference="alignment:Splign:1.39.8"
ORIGIN
cgggcgctttcctggaagagaagtgggtcaggcccaactgaaaagcaagcctggcaccagaagggggacattccggaactagatatgaagagacttttctccctgaagttccccggacccaattagatgttgtacccaggctggttaccctggtaacaggcgtcgcggtttgtcaaggaactgagagaagaggcttaagaaaattattcaccactcataagtcatggagacatcctcaaaaggtctgcttacccaagttactcagttttggaacctcctagatgatctagctcagagtgaccctgagggctatgagaagtttattcagcagcagctgaaagaagggaaacagctctgtgctgccccagaaccacagctttgtctacagaccaggattctgaaaccaaaagaaaaaatactttttatcaacctgtgtcagtggacaaggatcccagctccccaatcaaccactcatccagtacctctaactgttggcaaaccagaagatacaactgagatatcagatgcttacacagtcattgatgttgcctacaatcctgatgttcttcatgcagcagaaaaggaccaagtgaaaaaaaatcagttaattcagatggccatgaaatgcattgaggagaaattccagttcaccctctcacactcttaccatattaccaaatttagaataaaaggaagcattcaaagaatgaaacaaaatctgatgggaatccaaactgattccatagatttaagagaaaaaatgagaagggaactaactcttggacagatacgaagcagtactatgagcaatccagatcactttcctcaactgttactgccaaaagaccaagtttcaggcaaagcagtgtgtctgatagaagagatttccagtactgaaatccaggtggagatgaagatgccagcctatgaactaaaaattgtgcatgatcacagtgagaaacctctgaaaattgagttgaaagttgaattacctggtattaattctgtctctctctgtgaccttagtgtttctgagggaacaacagaaccacaagcattagcgaaagatgaattatctttgaagttttgaatgtttgaaccagatttggatcatattgatgatggtcccttgtgataagcttgtttcttttggataatcttcaacctaaaattactaattactgaaaaatcaaattaatgtattgttttcataataatacagcaaggtaaaagtctgtgtggaatataaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.