2025-10-13 22:18:28, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_182739 828 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa (NDUFB6), transcript variant 2, mRNA. ACCESSION NM_182739 VERSION NM_182739.2 GI:316983172 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 828) AUTHORS Kennedy,R.B., Ovsyannikova,I.G., Pankratz,V.S., Haralambieva,I.H., Vierkant,R.A. and Poland,G.A. TITLE Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients JOURNAL Hum. Genet. 131 (9), 1403-1421 (2012) PUBMED 22610502 REFERENCE 2 (bases 1 to 828) AUTHORS Loublier,S., Bayot,A., Rak,M., El-Khoury,R., Benit,P. and Rustin,P. TITLE The NDUFB6 subunit of the mitochondrial respiratory chain complex I is required for electron transfer activity: a proof of principle study on stable and controlled RNA interference in human cell lines JOURNAL Biochem. Biophys. Res. Commun. 414 (2), 367-372 (2011) PUBMED 21964293 REMARK GeneRIF: NDUFB6 subunit is required for complex I activity. REFERENCE 3 (bases 1 to 828) AUTHORS Hendrickson,S.L., Lautenberger,J.A., Chinn,L.W., Malasky,M., Sezgin,E., Kingsley,L.A., Goedert,J.J., Kirk,G.D., Gomperts,E.D., Buchbinder,S.P., Troyer,J.L. and O'Brien,S.J. TITLE Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression JOURNAL PLoS ONE 5 (9), E12862 (2010) PUBMED 20877624 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) Publication Status: Online-Only REFERENCE 4 (bases 1 to 828) AUTHORS Kacerovsky-Bielesz,G., Chmelik,M., Ling,C., Pokan,R., Szendroedi,J., Farukuoye,M., Kacerovsky,M., Schmid,A.I., Gruber,S., Wolzt,M., Moser,E., Pacini,G., Smekal,G., Groop,L. and Roden,M. TITLE Short-term exercise training does not stimulate skeletal muscle ATP synthesis in relatives of humans with type 2 diabetes JOURNAL Diabetes 58 (6), 1333-1341 (2009) PUBMED 19265027 REMARK GeneRIF: Polymorphism in the NDUFB6 gene from respiratory chain complex I related to ATP synthesis and insulin sensitivity response to exercise training found in relatives of humans with type 2 diabetes. GeneRIF: Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) REFERENCE 5 (bases 1 to 828) AUTHORS Wang,L., McDonnell,S.K., Hebbring,S.J., Cunningham,J.M., St Sauver,J., Cerhan,J.R., Isaya,G., Schaid,D.J. and Thibodeau,S.N. TITLE Polymorphisms in mitochondrial genes and prostate cancer risk JOURNAL Cancer Epidemiol. Biomarkers Prev. 17 (12), 3558-3566 (2008) PUBMED 19064571 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 6 (bases 1 to 828) AUTHORS Smeitink,J. and van den Heuvel,L. TITLE Human mitochondrial complex I in health and disease JOURNAL Am. J. Hum. Genet. 64 (6), 1505-1510 (1999) PUBMED 10330338 REMARK Review article REFERENCE 7 (bases 1 to 828) AUTHORS Loeffen,J.L., Triepels,R.H., van den Heuvel,L.P., Schuelke,M., Buskens,C.A., Smeets,R.J., Trijbels,J.M. and Smeitink,J.A. TITLE cDNA of eight nuclear encoded subunits of NADH:ubiquinone oxidoreductase: human complex I cDNA characterization completed JOURNAL Biochem. Biophys. Res. Commun. 253 (2), 415-422 (1998) PUBMED 9878551 REFERENCE 8 (bases 1 to 828) AUTHORS Smeitink,J., Loeffen,J., Smeets,R., Triepels,R., Ruitenbeek,W., Trijbels,F. and van den Heuvel,L. TITLE Molecular characterization and mutational analysis of the human B17 subunit of the mitochondrial respiratory chain complex I JOURNAL Hum. Genet. 103 (2), 245-250 (1998) PUBMED 9760212 REFERENCE 9 (bases 1 to 828) AUTHORS Emahazion,T., Beskow,A., Gyllensten,U. and Brookes,A.J. TITLE Intron based radiation hybrid mapping of 15 complex I genes of the human electron transport chain JOURNAL Cytogenet. Cell Genet. 82 (1-2), 115-119 (1998) PUBMED 9763677 REFERENCE 10 (bases 1 to 828) AUTHORS Earley,F.G. and Ragan,C.I. TITLE Identification of the subunits of bovine heart mitochondrial NADH dehydrogenase that are exposed to the phospholipid bilayer by photo-labelling with 5-iodonaphth-1-yl azide JOURNAL Biochem. J. 191 (2), 429-436 (1980) PUBMED 7236204 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CB140469.1, BI669356.1 and BG220924.1. This sequence is a reference standard in the RefSeqGene project. On Jan 5, 2011 this sequence version replaced gi:33519468. Summary: The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jan 2011]. Transcript Variant: This variant (2) lacks an alternate in-frame exon compared to variant 1. The resulting isoform (2) has the same N- and C-termini but is shorter compared to isoform 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BI669356.1, BU599236.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: reported by MitoCarta ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-44 CB140469.1 1-44 45-691 BI669356.1 24-670 692-828 BG220924.1 348-484 FEATURES Location/Qualifiers source 1..828 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="9" /map="9p21.1" gene 1..828 /gene="NDUFB6" /gene_synonym="B17; CI" /note="NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa" /db_xref="GeneID:4712" /db_xref="HGNC:7701" /db_xref="HPRD:04504" /db_xref="MIM:603322" exon 1..304 /gene="NDUFB6" /gene_synonym="B17; CI" /inference="alignment:Splign:1.39.8" variation 36 /gene="NDUFB6" /gene_synonym="B17; CI" /replace="c" /replace="g" /db_xref="dbSNP:631678" misc_feature 71..73 /gene="NDUFB6" /gene_synonym="B17; CI" /note="upstream in-frame stop codon" CDS 125..466 /gene="NDUFB6" /gene_synonym="B17; CI" /EC_number="1.6.5.3" /EC_number="1.6.99.3" /note="isoform 2 is encoded by transcript variant 2; NADH-ubiquinone oxidoreductase beta subunit, 6; NADH-ubiquinone oxidoreductase B17 subunit; complex I, mitochondrial respiratory chain, B17 subunit; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; CI-B17; complex I-B17" /codon_start=1 /product="NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 isoform 2" /protein_id="NP_877416.1" /db_xref="GI:33519469" /db_xref="CCDS:CCDS6529.1" /db_xref="GeneID:4712" /db_xref="HGNC:7701" /db_xref="HPRD:04504" /db_xref="MIM:603322" /translation="
MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSGDTILETGEVIPPMKEFPDQHH
" misc_feature <197..463 /gene="NDUFB6" /gene_synonym="B17; CI" /note="NADH:ubiquinone oxidoreductase, NDUFB6/B17 subunit; Region: NDUF_B6; pfam09782" /db_xref="CDD:150450" variation 234 /gene="NDUFB6" /gene_synonym="B17; CI" /replace="a" /replace="c" /db_xref="dbSNP:11540819" variation 291 /gene="NDUFB6" /gene_synonym="B17; CI" /replace="c" /replace="t" /db_xref="dbSNP:3204903" exon 305..397 /gene="NDUFB6" /gene_synonym="B17; CI" /inference="alignment:Splign:1.39.8" exon 398..816 /gene="NDUFB6" /gene_synonym="B17; CI" /inference="alignment:Splign:1.39.8" STS 439..513 /gene="NDUFB6" /gene_synonym="B17; CI" /standard_name="G30177" /db_xref="UniSTS:62369" STS 441..662 /gene="NDUFB6" /gene_synonym="B17; CI" /standard_name="RH81057" /db_xref="UniSTS:87749" polyA_signal 462..467 /gene="NDUFB6" /gene_synonym="B17; CI" polyA_site 487 /gene="NDUFB6" /gene_synonym="B17; CI" polyA_signal 553..558 /gene="NDUFB6" /gene_synonym="B17; CI" polyA_site 579 /gene="NDUFB6" /gene_synonym="B17; CI" polyA_site 654 /gene="NDUFB6" /gene_synonym="B17; CI" STS 676..796 /gene="NDUFB6" /gene_synonym="B17; CI" /standard_name="STS-H04756" /db_xref="UniSTS:57886" polyA_signal 797..802 /gene="NDUFB6" /gene_synonym="B17; CI" polyA_site 816 /gene="NDUFB6" /gene_synonym="B17; CI" ORIGIN
gtaataaccgcgcgcggcgctcggcgttcccgcaaggtcgctttgcagagcgggagcgcgcttaagtaactagtccgtagttcgagggtgcgccgtgtccttttgcgttggtaccagcggcgacatgacggggtacactccggatgagaaactgcggctgcagcagctgcgagagctgagaaggcgatggctgaaggaccaggagctgagccctcgggagccggtgctgcccccacagaagatggggcctatggagaaattctggaataaatttttggagaataaatccccttggaggaaaatggtccatggggtatacaaaaagagtatctttgttttcactcatgtacttgtacctgtctggattattcattattacatgaagtatcatgtttctggtgatacaattctggagactggagaagtaattccaccaatgaaagaatttcctgatcaacatcattaaagattatgtaaaaagttaaaaggcttatgagcctaagtttgttcctatattaccatatttactgaattttctggaaaagtaactttaataaagtttaatctcagaaattgtcatatctgttttcaagcattgtacaatttgagactgagtaatttaacaataagtaaaaagtggacatgctaaacaaatatgagagactacctactttttctggtcattcttgacttggaaaacggtatggaaaagtatttagttacatgtttgtttgtttttttcttacacagtacttacactaatttggtatcagggtatgcaacagtgaaatatcacaataaacaaatgtaagaacaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:4712 -> Molecular function: GO:0008137 [NADH dehydrogenase (ubiquinone) activity] evidence: NAS GeneID:4712 -> Biological process: GO:0006120 [mitochondrial electron transport, NADH to ubiquinone] evidence: NAS GeneID:4712 -> Biological process: GO:0022904 [respiratory electron transport chain] evidence: TAS GeneID:4712 -> Biological process: GO:0044237 [cellular metabolic process] evidence: TAS GeneID:4712 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS GeneID:4712 -> Cellular component: GO:0005634 [nucleus] evidence: IDA GeneID:4712 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA GeneID:4712 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA GeneID:4712 -> Cellular component: GO:0005743 [mitochondrial inner membrane] evidence: TAS GeneID:4712 -> Cellular component: GO:0005747 [mitochondrial respiratory chain complex I] evidence: IDA GeneID:4712 -> Cellular component: GO:0005747 [mitochondrial respiratory chain complex I] evidence: NAS GeneID:4712 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA GeneID:4712 -> Cellular component: GO:0031966 [mitochondrial membrane] evidence: IDA ANNOTATIONS from NCBI Entrez Gene (20130726): NP_877416 -> EC 1.6.5.3 NP_877416 -> EC 1.6.99.3
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.