GGRNA ver.2 Help | Advanced search | Japanese    Previous release (v1)

2022-09-25 16:14:25, GGRNA : RefSeq release 212 (May, 2022)

Summary:

Results:

Matches are highlighted with green background. Overlapping matches are dark colored.

Xenopus laevis vimentin S homeolog (vim.S), mRNA. (1787 bp)
LOCUS NM_001087438 1787 bp mRNA linear VRT 09-MAR-2022 DEFINITION Xenopus laevis vimentin S homeolog (vim.S), mRNA. ACCESSION NM_001087438 VERSION NM_001087438.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC054161.1. ##Evidence-Data-START## Transcript exon combination ::...
Synonym: vim; vim-a; vim-b; vim4
NM_001087438.1 - Xenopus laevis (African clawed frog) - NCBI
Xenopus tropicalis vimentin (vim), mRNA. (1795 bp)
LOCUS NM_001134803 1795 bp mRNA linear VRT 22-DEC-2019 DEFINITION Xenopus tropicalis vimentin (vim), mRNA. ACCESSION NM_001134803 VERSION NM_001134803.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Silurana. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC168783.1. ##Evidence-Data-START## Transcript exon combination ::...
Synonym: vim-a; vim-b
NM_001134803.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Xenopus laevis vimentin L homeolog (vim.L), mRNA. (1709 bp)
LOCUS NM_001087439 1709 bp mRNA linear VRT 20-JUN-2021 DEFINITION Xenopus laevis vimentin L homeolog (vim.L), mRNA. ACCESSION NM_001087439 VERSION NM_001087439.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC080051.1. ##Evidence-Data-START## Transcript exon combination ::...
Synonym: vim; vim-a; vim-b; vim1; vim2
NM_001087439.1 - Xenopus laevis (African clawed frog) - NCBI
Salmo salar vimentin (vim), mRNA. (2065 bp)
Publication Status: Online-Only REFERENCE 2 (bases 1 to 2065) AUTHORS Sagstad A, Grotmol S, Kryvi H, Krossoy C, Totland GK, Malde K, Wang S, Hansen T and Wargelius A. TITLE Identification of vimentin- and elastin-like transcripts specifically expressed in developing notochord of Atlantic salmon (Salmo salar L.) JOURNAL Cell Tissue Res 346 (2), 191-202 (2011) PUBMED 22057848 REMARK GeneRIF: Vimentin- like transcript was expressed in both chordocytes and chordoblasts, whereas the elastin- like transcript was uniquely expressed in the chordoblasts lining the notochordal sheath. REFERENCE 3...
Synonym: vime
NM_001140475.1 - Salmo salar (Atlantic salmon) - NCBI
PREDICTED: Carlito syrichta vimentin (VIM), transcript variant X2, mRNA. (1048 bp)
LOCUS XM_021711502 1048 bp mRNA linear PRI 01-JUL-2017 DEFINITION PREDICTED: Carlito syrichta vimentin (VIM), transcript variant X2, mRNA. ACCESSION XM_021711502 VERSION XM_021711502.1 DBLINK BioProject: PRJNA236776 KEYWORDS RefSeq. SOURCE Carlito syrichta (Philippine tarsier) ORGANISM Carlito syrichta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Tarsiiformes; Tarsiidae; Carlito. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_021711502.1 - Carlito syrichta (Philippine tarsier) - NCBI
PREDICTED: Gavialis gangeticus vimentin (VIM), mRNA. (1755 bp)
LOCUS XM_019508342 1755 bp mRNA linear VRT 16-DEC-2016 DEFINITION PREDICTED: Gavialis gangeticus vimentin (VIM), mRNA. ACCESSION XM_019508342 VERSION XM_019508342.1 DBLINK BioProject: PRJNA357062 KEYWORDS RefSeq. SOURCE Gavialis gangeticus (Gharial) ORGANISM Gavialis gangeticus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Crocodylia; Longirostres; Gavialidae; Gavialinae; Gavialis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_017729004.1) annotated using...
XM_019508342.1 - Gavialis gangeticus (Gharial) - NCBI
PREDICTED: Ictalurus punctatus vimentin like (viml), transcript variant X3, misc_RNA. (1462 bp)
LOCUS XR_001815827 1462 bp RNA linear VRT 23-MAR-2022 DEFINITION PREDICTED: Ictalurus punctatus vimentin like (viml), transcript variant X3, misc_RNA. ACCESSION XR_001815827 VERSION XR_001815827.2 DBLINK BioProject: PRJNA327588 KEYWORDS RefSeq. SOURCE Ictalurus punctatus (channel catfish) ORGANISM Ictalurus punctatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Ictaluridae; Ictalurus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XR_001815827.2 - Ictalurus punctatus (channel catfish) - NCBI
PREDICTED: Tachysurus fulvidraco vimentin (vim), transcript variant X2, misc_RNA. (1803 bp)
LOCUS XR_003440956 1803 bp RNA linear VRT 20-APR-2022 DEFINITION PREDICTED: Tachysurus fulvidraco vimentin (vim), transcript variant X2, misc_RNA. ACCESSION XR_003440956 VERSION XR_003440956.2 DBLINK BioProject: PRJNA826113 KEYWORDS RefSeq. SOURCE Tachysurus fulvidraco (yellow catfish) ORGANISM Tachysurus fulvidraco Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Bagridae; Tachysurus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XR_003440956.2 - Tachysurus fulvidraco (yellow catfish) - NCBI
PREDICTED: Hipposideros armiger vimentin (VIM), mRNA. (1891 bp)
LOCUS XM_019662940 1891 bp mRNA linear MAM 20-DEC-2016 DEFINITION PREDICTED: Hipposideros armiger vimentin (VIM), mRNA. ACCESSION XM_019662940 VERSION XM_019662940.1 DBLINK BioProject: PRJNA357596 KEYWORDS RefSeq. SOURCE Hipposideros armiger (great roundleaf bat) ORGANISM Hipposideros armiger Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Hipposideridae; Hipposideros. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_019662940.1 - Hipposideros armiger (great roundleaf bat) - NCBI
PREDICTED: Tachysurus fulvidraco vimentin like (viml), transcript variant X4, misc_RNA. (2067 bp)
LOCUS XR_003443741 2067 bp RNA linear VRT 20-APR-2022 DEFINITION PREDICTED: Tachysurus fulvidraco vimentin like (viml), transcript variant X4, misc_RNA. ACCESSION XR_003443741 VERSION XR_003443741.2 DBLINK BioProject: PRJNA826113 KEYWORDS RefSeq. SOURCE Tachysurus fulvidraco (yellow catfish) ORGANISM Tachysurus fulvidraco Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Bagridae; Tachysurus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a...
XR_003443741.2 - Tachysurus fulvidraco (yellow catfish) - NCBI
PREDICTED: Tachysurus fulvidraco vimentin like (viml), transcript variant X2, misc_RNA. (2079 bp)
LOCUS XR_003443740 2079 bp RNA linear VRT 20-APR-2022 DEFINITION PREDICTED: Tachysurus fulvidraco vimentin like (viml), transcript variant X2, misc_RNA. ACCESSION XR_003443740 VERSION XR_003443740.2 DBLINK BioProject: PRJNA826113 KEYWORDS RefSeq. SOURCE Tachysurus fulvidraco (yellow catfish) ORGANISM Tachysurus fulvidraco Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Bagridae; Tachysurus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a...
XR_003443740.2 - Tachysurus fulvidraco (yellow catfish) - NCBI
PREDICTED: Crocodylus porosus vimentin (VIM), mRNA. (1863 bp)
LOCUS XM_019530258 1863 bp mRNA linear VRT 20-DEC-2016 DEFINITION PREDICTED: Crocodylus porosus vimentin (VIM), mRNA. ACCESSION XM_019530258 VERSION XM_019530258.1 DBLINK BioProject: PRJNA357059 KEYWORDS RefSeq; includes ab initio. SOURCE Crocodylus porosus (Australian saltwater crocodile) ORGANISM Crocodylus porosus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Crocodylia; Longirostres; Crocodylidae; Crocodylus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_019530258.1 - Crocodylus porosus (Australian saltwater crocodile) - NCBI
PREDICTED: Paramormyrops kingsleyae vimentin (vim), mRNA. (1118 bp)
LOCUS XM_023790570 1118 bp mRNA linear VRT 03-FEB-2018 DEFINITION PREDICTED: Paramormyrops kingsleyae vimentin (vim), mRNA. ACCESSION XM_023790570 VERSION XM_023790570.1 DBLINK BioProject: PRJNA432421 KEYWORDS RefSeq; includes ab initio. SOURCE Paramormyrops kingsleyae ORGANISM Paramormyrops kingsleyae Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Osteoglossocephala; Osteoglossomorpha; Osteoglossiformes; Mormyridae; Paramormyrops. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is...
XM_023790570.1 - Paramormyrops kingsleyae - NCBI
PREDICTED: Silurus meridionalis vimentin (vim), partial mRNA. (975 bp)
LOCUS XM_046846099 975 bp mRNA linear VRT 18-FEB-2022 DEFINITION PREDICTED: Silurus meridionalis vimentin (vim), partial mRNA. ACCESSION XM_046846099 VERSION XM_046846099.1 DBLINK BioProject: PRJNA807317 KEYWORDS RefSeq. SOURCE Silurus meridionalis (Silurus soldatovi meridionalis) ORGANISM Silurus meridionalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Siluridae; Silurus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_046846099.1 - Silurus meridionalis (Silurus soldatovi meridionalis) - NCBI
PREDICTED: Carlito syrichta vimentin (VIM), transcript variant X1, mRNA. (1172 bp)
gene="VIM" /codon_start=1 /product="vimentin isoform X1" /protein_id="XP_008054526.1" /db_xref="GeneID:103258679" /translation="MLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE" misc_feature <33..680 /gene="VIM" /note="Intermediate filament protein; Region: Filament; pfam00038" /db_xref="CDD:278467" STS 86..213 /gene="VIM" /standard_name="Vim" /db_xref="UniSTS:527007" STS...
XM_008056335.1 - Carlito syrichta (Philippine tarsier) - NCBI
PREDICTED: Panthera pardus vimentin (VIM), mRNA. (1893 bp)
LOCUS XM_019460658 1893 bp mRNA linear MAM 05-DEC-2016 DEFINITION PREDICTED: Panthera pardus vimentin (VIM), mRNA. ACCESSION XM_019460658 VERSION XM_019460658.1 DBLINK BioProject: PRJNA355165 KEYWORDS RefSeq. SOURCE Panthera pardus (leopard) ORGANISM Panthera pardus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae; Pantherinae; Panthera. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_017619881.1) annotated using gene...
XM_019460658.1 - Panthera pardus (leopard) - NCBI
PREDICTED: Monopterus albus vimentin (vim), mRNA. (1859 bp)
LOCUS XM_020591662 1859 bp mRNA linear VRT 27-MAR-2017 DEFINITION PREDICTED: Monopterus albus vimentin (vim), mRNA. ACCESSION XM_020591662 VERSION XM_020591662.1 DBLINK BioProject: PRJNA380265 KEYWORDS RefSeq. SOURCE Monopterus albus (swamp eel) ORGANISM Monopterus albus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Anabantaria; Synbranchiformes; Synbranchidae; Monopterus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_020591662.1 - Monopterus albus (swamp eel) - NCBI
PREDICTED: Meles meles vimentin (VIM), mRNA. (1837 bp)
LOCUS XM_046013582 1837 bp mRNA linear MAM 05-MAR-2022 DEFINITION PREDICTED: Meles meles vimentin (VIM), mRNA. ACCESSION XM_046013582 VERSION XM_046013582.1 DBLINK BioProject: PRJNA796981 KEYWORDS RefSeq. SOURCE Meles meles (Eurasian badger) ORGANISM Meles meles Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae; Melinae; Meles. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060072) annotated using gene prediction method:...
XM_046013582.1 - Meles meles (Eurasian badger) - NCBI
PREDICTED: Silurus meridionalis vimentin-related 2 (vimr2), mRNA. (2094 bp)
LOCUS XM_046850058 2094 bp mRNA linear VRT 18-FEB-2022 DEFINITION PREDICTED: Silurus meridionalis vimentin-related 2 (vimr2), mRNA. ACCESSION XM_046850058 VERSION XM_046850058.1 DBLINK BioProject: PRJNA807317 KEYWORDS RefSeq. SOURCE Silurus meridionalis (Silurus soldatovi meridionalis) ORGANISM Silurus meridionalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Siluridae; Silurus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_046850058.1 - Silurus meridionalis (Silurus soldatovi meridionalis) - NCBI
PREDICTED: Scatophagus argus vimentin-related 2 (vimr2), transcript variant X4, mRNA. (1261 bp)
LOCUS XM_046405676 1261 bp mRNA linear VRT 03-FEB-2022 DEFINITION PREDICTED: Scatophagus argus vimentin-related 2 (vimr2), transcript variant X4, mRNA. ACCESSION XM_046405676 VERSION XM_046405676.1 DBLINK BioProject: PRJNA776026 KEYWORDS RefSeq. SOURCE Scatophagus argus ORGANISM Scatophagus argus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Scatophagidae; Scatophagus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_046405676.1 - Scatophagus argus - NCBI
PREDICTED: Seriola dumerili vimentin (vim), mRNA. (1843 bp)
LOCUS XM_022757894 1843 bp mRNA linear VRT 04-OCT-2017 DEFINITION PREDICTED: Seriola dumerili vimentin (vim), mRNA. ACCESSION XM_022757894 VERSION XM_022757894.1 DBLINK BioProject: PRJNA412910 KEYWORDS RefSeq. SOURCE Seriola dumerili (greater amberjack) ORGANISM Seriola dumerili Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Carangaria; Carangiformes; Carangidae; Seriola. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_022757894.1 - Seriola dumerili (greater amberjack) - NCBI
PREDICTED: Tachysurus fulvidraco vimentin-related 2 (vimr2), mRNA. (1845 bp)
LOCUS XM_027135297 1845 bp mRNA linear VRT 20-APR-2022 DEFINITION PREDICTED: Tachysurus fulvidraco vimentin-related 2 (vimr2), mRNA. ACCESSION XM_027135297 VERSION XM_027135297.2 DBLINK BioProject: PRJNA826113 KEYWORDS RefSeq. SOURCE Tachysurus fulvidraco (yellow catfish) ORGANISM Tachysurus fulvidraco Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Bagridae; Tachysurus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_027135297.2 - Tachysurus fulvidraco (yellow catfish) - NCBI
PREDICTED: Hypomesus transpacificus vimentin-related 2 (vimr2), mRNA. (2296 bp)
LOCUS XM_047021024 2296 bp mRNA linear VRT 04-MAR-2022 DEFINITION PREDICTED: Hypomesus transpacificus vimentin-related 2 (vimr2), mRNA. ACCESSION XM_047021024 VERSION XM_047021024.1 DBLINK BioProject: PRJNA810474 KEYWORDS RefSeq. SOURCE Hypomesus transpacificus ORGANISM Hypomesus transpacificus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Stomiati; Osmeriformes; Osmeridae; Hypomesus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_061060) annotated...
XM_047021024.1 - Hypomesus transpacificus - NCBI
PREDICTED: Castor canadensis vimentin (Vim), mRNA. (1944 bp)
LOCUS XM_020185626 1944 bp mRNA linear ROD 15-FEB-2017 DEFINITION PREDICTED: Castor canadensis vimentin (Vim), mRNA. ACCESSION XM_020185626 VERSION XM_020185626.1 DBLINK BioProject: PRJNA371604 KEYWORDS RefSeq. SOURCE Castor canadensis (American beaver) ORGANISM Castor canadensis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Castorimorpha; Castoridae; Castor. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_017872845.1) annotated...
XM_020185626.1 - Castor canadensis (American beaver) - NCBI
PREDICTED: Mugil cephalus vimentin-related 2 (vimr2), mRNA. (2228 bp)
LOCUS XM_047584628 2228 bp mRNA linear VRT 07-APR-2022 DEFINITION PREDICTED: Mugil cephalus vimentin-related 2 (vimr2), mRNA. ACCESSION XM_047584628 VERSION XM_047584628.1 DBLINK BioProject: PRJNA821704 KEYWORDS RefSeq. SOURCE Mugil cephalus (flathead mullet) ORGANISM Mugil cephalus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Ovalentaria; Mugilomorphae; Mugilidae; Mugil. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_047584628.1 - Mugil cephalus (flathead mullet) - NCBI
PREDICTED: Numida meleagris vimentin (VIM), mRNA. (2056 bp)
LOCUS XM_021387803 2056 bp mRNA linear VRT 07-JUN-2017 DEFINITION PREDICTED: Numida meleagris vimentin (VIM), mRNA. ACCESSION XM_021387803 VERSION XM_021387803.1 DBLINK BioProject: PRJNA383663 KEYWORDS RefSeq. SOURCE Numida meleagris (helmeted guineafowl) ORGANISM Numida meleagris Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Numididae; Numida. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
XM_021387803.1 - Numida meleagris (helmeted guineafowl) - NCBI
PREDICTED: Scatophagus argus vimentin-related 2 (vimr2), transcript variant X3, mRNA. (3030 bp)
LOCUS XM_046405675 3030 bp mRNA linear VRT 03-FEB-2022 DEFINITION PREDICTED: Scatophagus argus vimentin-related 2 (vimr2), transcript variant X3, mRNA. ACCESSION XM_046405675 VERSION XM_046405675.1 DBLINK BioProject: PRJNA776026 KEYWORDS RefSeq. SOURCE Scatophagus argus ORGANISM Scatophagus argus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Scatophagidae; Scatophagus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_046405675.1 - Scatophagus argus - NCBI
PREDICTED: Ictalurus punctatus vimentin-related 2 (vimr2), mRNA. (2469 bp)
LOCUS XM_047157109 2469 bp mRNA linear VRT 23-MAR-2022 DEFINITION PREDICTED: Ictalurus punctatus vimentin-related 2 (vimr2), mRNA. ACCESSION XM_047157109 VERSION XM_047157109.1 DBLINK BioProject: PRJNA327588 KEYWORDS RefSeq. SOURCE Ictalurus punctatus (channel catfish) ORGANISM Ictalurus punctatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Ictaluridae; Ictalurus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_047157109.1 - Ictalurus punctatus (channel catfish) - NCBI
PREDICTED: Scatophagus argus vimentin-related 2 (vimr2), transcript variant X2, mRNA. (2933 bp)
LOCUS XM_046405674 2933 bp mRNA linear VRT 03-FEB-2022 DEFINITION PREDICTED: Scatophagus argus vimentin-related 2 (vimr2), transcript variant X2, mRNA. ACCESSION XM_046405674 VERSION XM_046405674.1 DBLINK BioProject: PRJNA776026 KEYWORDS RefSeq. SOURCE Scatophagus argus ORGANISM Scatophagus argus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Scatophagidae; Scatophagus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_046405674.1 - Scatophagus argus - NCBI
PREDICTED: Scatophagus argus vimentin-related 2 (vimr2), transcript variant X1, mRNA. (2379 bp)
LOCUS XM_046405673 2379 bp mRNA linear VRT 03-FEB-2022 DEFINITION PREDICTED: Scatophagus argus vimentin-related 2 (vimr2), transcript variant X1, mRNA. ACCESSION XM_046405673 VERSION XM_046405673.1 DBLINK BioProject: PRJNA776026 KEYWORDS RefSeq. SOURCE Scatophagus argus ORGANISM Scatophagus argus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Scatophagidae; Scatophagus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_046405673.1 - Scatophagus argus - NCBI
PREDICTED: Silurus meridionalis vimentin like (viml), mRNA. (1953 bp)
LOCUS XM_046876042 1953 bp mRNA linear VRT 18-FEB-2022 DEFINITION PREDICTED: Silurus meridionalis vimentin like (viml), mRNA. ACCESSION XM_046876042 VERSION XM_046876042.1 DBLINK BioProject: PRJNA807317 KEYWORDS RefSeq. SOURCE Silurus meridionalis (Silurus soldatovi meridionalis) ORGANISM Silurus meridionalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Siluridae; Silurus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_046876042.1 - Silurus meridionalis (Silurus soldatovi meridionalis) - NCBI
PREDICTED: Salmo salar vimentin-related 2 (vimr2), mRNA. (2133 bp)
LOCUS XM_014211819 2133 bp mRNA linear VRT 07-JAN-2022 DEFINITION PREDICTED: Salmo salar vimentin-related 2 (vimr2), mRNA. ACCESSION XM_014211819 VERSION XM_014211819.2 DBLINK BioProject: PRJNA788898 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_059450) annotated...
XM_014211819.2 - Salmo salar (Atlantic salmon) - NCBI
PREDICTED: Oryzias latipes vimentin (vim), mRNA. (1781 bp)
LOCUS XM_004079440 1781 bp mRNA linear VRT 15-FEB-2018 DEFINITION PREDICTED: Oryzias latipes vimentin (vim), mRNA. ACCESSION XM_004079440 VERSION XM_004079440.4 DBLINK BioProject: PRJNA183868 KEYWORDS RefSeq. SOURCE Oryzias latipes (Japanese medaka) ORGANISM Oryzias latipes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Ovalentaria; Atherinomorphae; Beloniformes; Adrianichthyidae; Oryziinae; Oryzias. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived...
XM_004079440.4 - Oryzias latipes (Japanese medaka) - NCBI
PREDICTED: Leopardus geoffroyi vimentin (VIM), mRNA. (2569 bp)
LOCUS XM_045463405 2569 bp mRNA linear MAM 17-DEC-2021 DEFINITION PREDICTED: Leopardus geoffroyi vimentin (VIM), mRNA. ACCESSION XM_045463405 VERSION XM_045463405.1 DBLINK BioProject: PRJNA786922 KEYWORDS RefSeq. SOURCE Leopardus geoffroyi (Geoffroy's cat) ORGANISM Leopardus geoffroyi Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae; Felinae; Leopardus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_059341) annotated using...
XM_045463405.1 - Leopardus geoffroyi (Geoffroy's cat) - NCBI
PREDICTED: Scophthalmus maximus vimentin-related 2 (vimr2), mRNA. (2156 bp)
LOCUS XM_035649229 2156 bp mRNA linear VRT 01-APR-2022 DEFINITION PREDICTED: Scophthalmus maximus vimentin-related 2 (vimr2), mRNA. ACCESSION XM_035649229 VERSION XM_035649229.2 DBLINK BioProject: PRJNA821077 KEYWORDS RefSeq. SOURCE Scophthalmus maximus (turbot) ORGANISM Scophthalmus maximus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Carangaria; Pleuronectiformes; Pleuronectoidei; Scophthalmidae; Scophthalmus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This...
XM_035649229.2 - Scophthalmus maximus (turbot) - NCBI
PREDICTED: Astyanax mexicanus vimentin (vim), transcript variant X2, mRNA. (1876 bp)
LOCUS XM_007250368 1876 bp mRNA linear VRT 03-OCT-2017 DEFINITION PREDICTED: Astyanax mexicanus vimentin (vim), transcript variant X2, mRNA. ACCESSION XM_007250368 VERSION XM_007250368.3 DBLINK BioProject: PRJNA237016 KEYWORDS RefSeq. SOURCE Astyanax mexicanus (Mexican tetra) ORGANISM Astyanax mexicanus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Characiformes; Characoidei; Characidae; Astyanax. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_007250368.3 - Astyanax mexicanus (Mexican tetra) - NCBI
PREDICTED: Oncorhynchus gorbuscha vimentin-related 2 (vimr2), mRNA. (1710 bp)
LOCUS XM_046323339 1710 bp mRNA linear VRT 05-MAR-2022 DEFINITION PREDICTED: Oncorhynchus gorbuscha vimentin-related 2 (vimr2), mRNA. ACCESSION XM_046323339 VERSION XM_046323339.1 DBLINK BioProject: PRJNA726253 KEYWORDS RefSeq; includes ab initio. SOURCE Oncorhynchus gorbuscha (pink salmon) ORGANISM Oncorhynchus gorbuscha Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record...
XM_046323339.1 - Oncorhynchus gorbuscha (pink salmon) - NCBI
PREDICTED: Meriones unguiculatus vimentin (Vim), mRNA. (2220 bp)
LOCUS XM_021627622 2220 bp mRNA linear ROD 27-JUN-2017 DEFINITION PREDICTED: Meriones unguiculatus vimentin (Vim), mRNA. ACCESSION XM_021627622 VERSION XM_021627622.1 DBLINK BioProject: PRJNA391923 KEYWORDS RefSeq. SOURCE Meriones unguiculatus (Mongolian gerbil) ORGANISM Meriones unguiculatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Gerbillinae; Meriones. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_021627622.1 - Meriones unguiculatus (Mongolian gerbil) - NCBI
PREDICTED: Rhinolophus sinicus vimentin (VIM), mRNA. (1883 bp)
LOCUS XM_019746073 1883 bp mRNA linear MAM 22-DEC-2016 DEFINITION PREDICTED: Rhinolophus sinicus vimentin (VIM), mRNA. ACCESSION XM_019746073 VERSION XM_019746073.1 DBLINK BioProject: PRJNA358073 KEYWORDS RefSeq. SOURCE Rhinolophus sinicus (Chinese rufous horseshoe bat) ORGANISM Rhinolophus sinicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Rhinolophidae; Rhinolophinae; Rhinolophus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_019746073.1 - Rhinolophus sinicus (Chinese rufous horseshoe bat) - NCBI
PREDICTED: Danio rerio vimentin (vim), transcript variant X1, mRNA. (1905 bp)
LOCUS XM_021470110 1905 bp mRNA linear VRT 15-JUN-2017 DEFINITION PREDICTED: Danio rerio vimentin (vim), transcript variant X1, mRNA. ACCESSION XM_021470110 VERSION XM_021470110.1 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_007135.7) annotated...
Synonym: cb28
XM_021470110.1 - Danio rerio (zebrafish) - NCBI - UCSC
PREDICTED: Bos indicus vimentin (VIM), mRNA. (1911 bp)
LOCUS XM_019973110 1911 bp mRNA linear MAM 12-JAN-2017 DEFINITION PREDICTED: Bos indicus vimentin (VIM), mRNA. ACCESSION XM_019973110 VERSION XM_019973110.1 DBLINK BioProject: PRJNA360096 KEYWORDS RefSeq. SOURCE Bos indicus (Bos taurus indicus) ORGANISM Bos indicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_032662.1) annotated using gene...
XM_019973110.1 - Bos indicus (Bos taurus indicus) - NCBI
PREDICTED: Marmota monax vimentin (Vim), mRNA. (1860 bp)
LOCUS XM_046423051 1860 bp mRNA linear ROD 05-MAR-2022 DEFINITION PREDICTED: Marmota monax vimentin (Vim), mRNA. ACCESSION XM_046423051 VERSION XM_046423051.1 DBLINK BioProject: PRJNA797297 KEYWORDS RefSeq. SOURCE Marmota monax (woodchuck) ORGANISM Marmota monax Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciuromorpha; Sciuridae; Xerinae; Marmotini; Marmota. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_025724348) annotated using...
XM_046423051.1 - Marmota monax (woodchuck) - NCBI
PREDICTED: Seriola lalandi dorsalis vimentin (vim), mRNA. (1849 bp)
LOCUS XM_023408951 1849 bp mRNA linear VRT 26-DEC-2017 DEFINITION PREDICTED: Seriola lalandi dorsalis vimentin (vim), mRNA. ACCESSION XM_023408951 VERSION XM_023408951.1 DBLINK BioProject: PRJNA423295 KEYWORDS RefSeq. SOURCE Seriola lalandi dorsalis ORGANISM Seriola lalandi dorsalis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Carangaria; Carangiformes; Carangidae; Seriola. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
XM_023408951.1 - Seriola lalandi dorsalis - NCBI
PREDICTED: Hypomesus transpacificus vimentin like (viml), mRNA. (1875 bp)
LOCUS XM_047027798 1875 bp mRNA linear VRT 04-MAR-2022 DEFINITION PREDICTED: Hypomesus transpacificus vimentin like (viml), mRNA. ACCESSION XM_047027798 VERSION XM_047027798.1 DBLINK BioProject: PRJNA810474 KEYWORDS RefSeq. SOURCE Hypomesus transpacificus ORGANISM Hypomesus transpacificus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Stomiati; Osmeriformes; Osmeridae; Hypomesus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_061069) annotated using...
XM_047027798.1 - Hypomesus transpacificus - NCBI
PREDICTED: Tachysurus fulvidraco vimentin like (viml), transcript variant X5, mRNA. (1942 bp)
LOCUS XM_027166108 1942 bp mRNA linear VRT 20-APR-2022 DEFINITION PREDICTED: Tachysurus fulvidraco vimentin like (viml), transcript variant X5, mRNA. ACCESSION XM_027166108 VERSION XM_027166108.2 DBLINK BioProject: PRJNA826113 KEYWORDS RefSeq. SOURCE Tachysurus fulvidraco (yellow catfish) ORGANISM Tachysurus fulvidraco Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Bagridae; Tachysurus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_027166108.2 - Tachysurus fulvidraco (yellow catfish) - NCBI
PREDICTED: Girardinichthys multiradiatus vimentin-related 2 (vimr2), mRNA. (2050 bp)
LOCUS XM_047352943 2050 bp mRNA linear VRT 03-APR-2022 DEFINITION PREDICTED: Girardinichthys multiradiatus vimentin-related 2 (vimr2), mRNA. ACCESSION XM_047352943 VERSION XM_047352943.1 DBLINK BioProject: PRJNA821872 KEYWORDS RefSeq. SOURCE Girardinichthys multiradiatus ORGANISM Girardinichthys multiradiatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Ovalentaria; Atherinomorphae; Cyprinodontiformes; Goodeidae; Girardinichthys. COMMENT MODEL REFSEQ: This record is predicted by automated computational...
XM_047352943.1 - Girardinichthys multiradiatus - NCBI
PREDICTED: Mirounga angustirostris vimentin (VIM), mRNA. (1922 bp)
LOCUS XM_045874337 1922 bp mRNA linear MAM 13-JAN-2022 DEFINITION PREDICTED: Mirounga angustirostris vimentin (VIM), mRNA. ACCESSION XM_045874337 VERSION XM_045874337.1 DBLINK BioProject: PRJNA795490 KEYWORDS RefSeq. SOURCE Mirounga angustirostris (Northern elephant seal) ORGANISM Mirounga angustirostris Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Phocidae; Mirounga. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_025578510)...
XM_045874337.1 - Mirounga angustirostris (Northern elephant seal) - NCBI
PREDICTED: Tachysurus fulvidraco vimentin like (viml), transcript variant X3, mRNA. (1981 bp)
LOCUS XM_027166107 1981 bp mRNA linear VRT 20-APR-2022 DEFINITION PREDICTED: Tachysurus fulvidraco vimentin like (viml), transcript variant X3, mRNA. ACCESSION XM_027166107 VERSION XM_027166107.2 DBLINK BioProject: PRJNA826113 KEYWORDS RefSeq. SOURCE Tachysurus fulvidraco (yellow catfish) ORGANISM Tachysurus fulvidraco Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Bagridae; Tachysurus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic...
XM_027166107.2 - Tachysurus fulvidraco (yellow catfish) - NCBI
PREDICTED: Micropterus dolomieu vimentin-related 2 (vimr2), mRNA. (2240 bp)
LOCUS XM_046030436 2240 bp mRNA linear VRT 05-MAR-2022 DEFINITION PREDICTED: Micropterus dolomieu vimentin-related 2 (vimr2), mRNA. ACCESSION XM_046030436 VERSION XM_046030436.1 DBLINK BioProject: PRJNA800460 KEYWORDS RefSeq. SOURCE Micropterus dolomieu (smallmouth bass) ORGANISM Micropterus dolomieu Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Centrarchiformes; Centrarchoidei; Centrarchidae; Micropterus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis....
XM_046030436.1 - Micropterus dolomieu (smallmouth bass) - NCBI
PREDICTED: Scatophagus argus vimentin like (viml), mRNA. (1836 bp)
LOCUS XM_046409382 1836 bp mRNA linear VRT 03-FEB-2022 DEFINITION PREDICTED: Scatophagus argus vimentin like (viml), mRNA. ACCESSION XM_046409382 VERSION XM_046409382.1 DBLINK BioProject: PRJNA776026 KEYWORDS RefSeq. SOURCE Scatophagus argus ORGANISM Scatophagus argus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Eupercaria; Scatophagidae; Scatophagus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_058505.1) annotated...
XM_046409382.1 - Scatophagus argus - NCBI

Data Export:

Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/symbol%3aVIM
lang : en | div : | spe : | query_string : symbol:VIM | format : html | download :

0.000 | 0.000 | search_start;
0.075 | 0.075 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=(full_search:symbol,synonym:VIM)?to=0&format=json
0.118 | 0.043 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=(full_search:symbol,synonym:VIM)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.124 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]