GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 19:12:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_173120               1173 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus selenoprotein S (Selenos), mRNA.
ACCESSION   NM_173120
VERSION     NM_173120.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1173)
  AUTHORS   Hughes DJ, Kunicka T, Schomburg L, Liska V, Swan N and Soucek P.
  TITLE     Expression of Selenoprotein Genes and Association with Selenium
            Status in Colorectal Adenoma and Colorectal Cancer
  JOURNAL   Nutrients 10 (11), 1812 (2018)
   PUBMED   30469315
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1173)
  AUTHORS   Gladyshev VN, Arner ES, Berry MJ, Brigelius-Flohe R, Bruford EA,
            Burk RF, Carlson BA, Castellano S, Chavatte L, Conrad M, Copeland
            PR, Diamond AM, Driscoll DM, Ferreiro A, Flohe L, Green FR, Guigo
            R, Handy DE, Hatfield DL, Hesketh J, Hoffmann PR, Holmgren A,
            Hondal RJ, Howard MT, Huang K, Kim HY, Kim IY, Kohrle J, Krol A,
            Kryukov GV, Lee BJ, Lee BC, Lei XG, Liu Q, Lescure A, Lobanov AV,
            Loscalzo J, Maiorino M, Mariotti M, Sandeep Prabhu K, Rayman MP,
            Rozovsky S, Salinas G, Schmidt EE, Schomburg L, Schweizer U,
            Simonovic M, Sunde RA, Tsuji PA, Tweedie S, Ursini F, Whanger PD
            and Zhang Y.
  TITLE     Selenoprotein Gene Nomenclature
  JOURNAL   J Biol Chem 291 (46), 24036-24040 (2016)
   PUBMED   27645994
REFERENCE   3  (bases 1 to 1173)
  AUTHORS   Ye Y, Fu F, Li X, Yang J and Liu H.
  TITLE     Selenoprotein S Is Highly Expressed in the Blood Vessels and
            Prevents Vascular Smooth Muscle Cells From Apoptosis
  JOURNAL   J Cell Biochem 117 (1), 106-117 (2016)
   PUBMED   26058460
  REMARK    GeneRIF: Selenoprotein S Is Highly Expressed in the Blood Vessels
            and Prevents Vascular Smooth Muscle Cells From Apoptosis
REFERENCE   4  (bases 1 to 1173)
  AUTHORS   Liu Y, Soetandyo N, Lee JG, Liu L, Xu Y, Clemons WM Jr and Ye Y.
  TITLE     USP13 antagonizes gp78 to maintain functionality of a chaperone in
            ER-associated degradation
  JOURNAL   Elife 3, e01369 (2014)
   PUBMED   24424410
REFERENCE   5  (bases 1 to 1173)
  AUTHORS   Bubenik JL, Miniard AC and Driscoll DM.
  TITLE     Alternative transcripts and 3'UTR elements govern the incorporation
            of selenocysteine into selenoprotein S
  JOURNAL   PLoS One 8 (4), e62102 (2013)
   PUBMED   23614019
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1173)
  AUTHORS   Curran JE, Jowett JB, Elliott KS, Gao Y, Gluschenko K, Wang J, Abel
            Azim DM, Cai G, Mahaney MC, Comuzzie AG, Dyer TD, Walder KR, Zimmet
            P, MacCluer JW, Collier GR, Kissebah AH and Blangero J.
  TITLE     Genetic variation in selenoprotein S influences inflammatory
            response
  JOURNAL   Nat Genet 37 (11), 1234-1241 (2005)
   PUBMED   16227999
REFERENCE   7  (bases 1 to 1173)
  AUTHORS   Ye Y, Shibata Y, Yun C, Ron D and Rapoport TA.
  TITLE     A membrane protein complex mediates retro-translocation from the ER
            lumen into the cytosol
  JOURNAL   Nature 429 (6994), 841-847 (2004)
   PUBMED   15215856
REFERENCE   8  (bases 1 to 1173)
  AUTHORS   Gao Y, Feng HC, Walder K, Bolton K, Sunderland T, Bishara N, Quick
            M, Kantham L and Collier GR.
  TITLE     Regulation of the selenoprotein SelS by glucose deprivation and
            endoplasmic reticulum stress - SelS is a novel glucose-regulated
            protein
  JOURNAL   FEBS Lett 563 (1-3), 185-190 (2004)
   PUBMED   15063746
REFERENCE   9  (bases 1 to 1173)
  AUTHORS   Kryukov GV, Castellano S, Novoselov SV, Lobanov AV, Zehtab O, Guigo
            R and Gladyshev VN.
  TITLE     Characterization of mammalian selenoproteomes
  JOURNAL   Science 300 (5624), 1439-1443 (2003)
   PUBMED   12775843
REFERENCE   10 (bases 1 to 1173)
  AUTHORS   Walder K, Kantham L, McMillan JS, Trevaskis J, Kerr L, De Silva A,
            Sunderland T, Godde N, Gao Y, Bishara N, Windmill K, Tenne-Brown J,
            Augert G, Zimmet PZ and Collier GR.
  TITLE     Tanis: a link between type 2 diabetes and inflammation?
  JOURNAL   Diabetes 51 (6), 1859-1866 (2002)
   PUBMED   12031974
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC059111.1 and AF367467.1.
            
            On Aug 2, 2006 this sequence version replaced NM_173120.1.
            
            Summary: This gene encodes a transmembrane protein that is
            localized in the endoplasmic reticulum (ER). It is involved in the
            degradation process of misfolded proteins in the ER, and may also
            have a role in inflammation control. This protein is a
            selenoprotein, containing the rare amino acid selenocysteine (Sec).
            Sec is encoded by the UGA codon, which normally signals translation
            termination. The 3' UTRs of selenoprotein mRNAs contain a conserved
            stem-loop structure, designated the Sec insertion sequence (SECIS)
            element, that is necessary for the recognition of UGA as a Sec
            codon, rather than as a stop signal. Two additional
            phylogenetically conserved stem-loop structures (Stem-loop 1 and
            Stem-loop 2) in the 3' UTR of this mRNA have been shown to function
            as modulators of Sec insertion (PMID:23614019). [provided by
            RefSeq, Jul 2017].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF367467.1, FQ218853.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            protein contains selenocysteine :: inferred from conservation
            RefSeq Select criteria          :: based on single protein-coding
                                               transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-945               BC059111.1         5-949
            946-1173            AF367467.1         956-1183
FEATURES             Location/Qualifiers
     source          1..1173
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q22"
     gene            1..1173
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /note="selenoprotein S"
                     /db_xref="GeneID:286900"
                     /db_xref="RGD:628897"
     exon            1..104
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    8..10
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /note="upstream in-frame stop codon"
     CDS             29..601
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /note="UGA stop codon recoded as selenocysteine; Tanis;
                     VCP-interacting membrane protein; VCP-interacting membrane
                     selenoprotein"
                     /codon_start=1
                     /transl_except=(pos:593..595,aa:Sec)
                     /product="selenoprotein S"
                     /protein_id="NP_775143.2"
                     /db_xref="GeneID:286900"
                     /db_xref="RGD:628897"
                     /translation="
MDRGEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCVLLYIVIQKLSLRLRALRQRQLDQAEAVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWDSMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPGRRGPSSGGUS"
     misc_feature    29..592
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:429198"
     misc_feature    110..172
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8VHV8.3);
                     transmembrane region"
     misc_feature    260..298
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8VHV8.3);
                     Region: VCP/p97-interacting motif (VIM).
                     /evidence=ECO:0000250|UniProtKB:Q9BQE4"
     misc_feature    311..598
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /note="propagated from UniProtKB/Swiss-Prot (Q8VHV8.3);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    593..595
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /note="Selenocysteine; other site"
     exon            105..239
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /inference="alignment:Splign:2.1.0"
     exon            240..346
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /inference="alignment:Splign:2.1.0"
     exon            347..436
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /inference="alignment:Splign:2.1.0"
     exon            437..515
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /inference="alignment:Splign:2.1.0"
     exon            516..1146
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /inference="alignment:Splign:2.1.0"
     regulatory      604..636
                     /regulatory_class="recoding_stimulatory_region"
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /note="Stem-loop 1"
                     /function="promotes selenocysteine insertion"
     regulatory      909..996
                     /regulatory_class="recoding_stimulatory_region"
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /note="SECIS_element"
                     /function="essential for recoding UGA to specify
                     selenocysteine"
     regulatory      1001..1027
                     /regulatory_class="other"
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
                     /note="recoding_inhibitory_region; Stem-loop 2"
                     /function="inhibits selenocysteine insertion"
     regulatory      1082..1087
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
     polyA_site      1101
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
     polyA_site      1146
                     /gene="Selenos"
                     /gene_synonym="Sels; sg2; Vimp"
ORIGIN      
gaagggctagtcgttggcggccgcagccatggatcgcggggaggaacctctgtccgcgaggccggcgctggagaccgagagcctgcgattcctgcacgtcacagtgggctccctgctggccagctatggctggtacatcctcttcagctgcgtccttctctacattgtcatccagaagctctccctgcgactgagggctttaaggcagaggcagctggaccaagctgaggctgttctggagcctgatgttgttgttaagcgacaagaggctttagcagctgctcgtttgagaatgcaggaagatctgaatgcccaagttgaaaaacataaggaaaaactaagacagcttgaagaagagaaaaggagacagaagattgaaatgtgggacagcatgcaagaaggcagaagttacaaaagaaactcaggaaggcctcaggaagaagatggtcctggaccttctacttcatcggtcatccccaaaggaaaatctgacaaaaagcctttacggggaggtggttataaccctctgacaggtgaagggggtggaacctgctcctggagacctggacgcaggggcccatcatctggtggatgaagctaagactcttgttagtgtcgctttgacattagcaaggtgaacccttaaccctcaactcaattgccttacgcacactttcacagtgactggccaaggagaggtagggctgatttctgttctgaacacctcatattttaagggctttggtcatagacattgccactaggccacactctagacgagacagctattggttttgtggccacttgctagtcagtaggttggaggcttcttgctgtttctcagacttcatcgaggaggcccagtgatggccctttggggcagaagtccttgatgacagacagggtggtctctgtgacaggatgcgttgaatgatgtcttccttataaatggtgagcccaccagtgaggattactgatgtacacagttgatggggtttgcttctgtatatttattttatgtacagaactttgtaaaaaaaaaaaagttaactacttaaaaagtaacatttttagcatctttattaaactcaaggaaatttctttgtgagcttgactttgtcagacagtaaacagctttttatcagtaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]