2024-05-19 18:34:45, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_052981 1230 bp mRNA linear ROD 15-JUL-2023 DEFINITION Rattus norvegicus cyclin H (Ccnh), mRNA. ACCESSION NM_052981 VERSION NM_052981.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1230) AUTHORS Wang KC, Nguyen P, Weiss A, Yeh YT, Chien HS, Lee A, Teng D, Subramaniam S, Li YS and Chien S. TITLE MicroRNA-23b regulates cyclin-dependent kinase-activating kinase complex through cyclin H repression to modulate endothelial transcription and growth under flow JOURNAL Arterioscler Thromb Vasc Biol 34 (7), 1437-1445 (2014) PUBMED 24855060 REMARK GeneRIF: Hemodynamic forces modulate EC proliferative phenotype through the miR-23b/CAK/cyclin H pathway. REFERENCE 2 (bases 1 to 1230) AUTHORS Wang Y, Liu F, Mao F, Hang Q, Huang X, He S, Wang Y, Cheng C, Wang H, Xu G, Zhang T and Shen A. TITLE Interaction with cyclin H/cyclin-dependent kinase 7 (CCNH/CDK7) stabilizes C-terminal binding protein 2 (CtBP2) and promotes cancer cell migration JOURNAL J Biol Chem 288 (13), 9028-9034 (2013) PUBMED 23393140 REFERENCE 3 (bases 1 to 1230) AUTHORS Fujii W, Nishimura T, Kano K, Sugiura K and Naito K. TITLE CDK7 and CCNH are components of CDK-activating kinase and are required for meiotic progression of pig oocytes JOURNAL Biol Reprod 85 (6), 1124-1132 (2011) PUBMED 21778139 REFERENCE 4 (bases 1 to 1230) AUTHORS Wu G, Cao J, Peng C, Yang H, Cui Z, Zhao J, Wu Q, Han J, Li H, Gu X and Zhang F. TITLE Temporal and spatial expression of cyclin H in rat spinal cord injury JOURNAL Neuromolecular Med 13 (3), 187-196 (2011) PUBMED 21710280 REMARK GeneRIF: Data suggest that cyclin H may play a proliferative role in spinal cord injury (SCI). REFERENCE 5 (bases 1 to 1230) AUTHORS Egly JM and Coin F. TITLE A history of TFIIH: two decades of molecular biology on a pivotal transcription/repair factor JOURNAL DNA Repair (Amst) 10 (7), 714-721 (2011) PUBMED 21592869 REMARK Review article REFERENCE 6 (bases 1 to 1230) AUTHORS Laes JF, Quan X, Ravoet M, Stieber D, Van Vooren P, Van Reeth T, Szpirer J and Szpirer C. TITLE Analysis of candidate genes included in the mammary cancer susceptibility 1 (Mcs1) region JOURNAL Mamm Genome 12 (3), 199-206 (2001) PUBMED 11252168 REFERENCE 7 (bases 1 to 1230) AUTHORS Jin K, Nagayama T, Chen J, Stetler AR, Kawaguchi K, Simon RP and Graham SH. TITLE Molecular cloning of a cell cycle regulation gene cyclin H from ischemic rat brain: expression in neurons after global cerebral ischemia JOURNAL J Neurochem 73 (4), 1598-1608 (1999) PUBMED 10501206 REFERENCE 8 (bases 1 to 1230) AUTHORS Kershnar E, Wu SY and Chiang CM. TITLE Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes JOURNAL J Biol Chem 273 (51), 34444-34453 (1998) PUBMED 9852112 REFERENCE 9 (bases 1 to 1230) AUTHORS Drapkin R, Le Roy G, Cho H, Akoulitchev S and Reinberg D. TITLE Human cyclin-dependent kinase-activating kinase exists in three distinct complexes JOURNAL Proc Natl Acad Sci U S A 93 (13), 6488-6493 (1996) PUBMED 8692842 REFERENCE 10 (bases 1 to 1230) AUTHORS Reardon JT, Ge H, Gibbs E, Sancar A, Hurwitz J and Pan ZQ. TITLE Isolation and characterization of two human transcription factor IIH (TFIIH)-related complexes: ERCC2/CAK and TFIIH JOURNAL Proc Natl Acad Sci U S A 93 (13), 6482-6487 (1996) PUBMED 8692841 REMARK Erratum:[Proc Natl Acad Sci U S A 1996 Sep 17;93(19):10538] COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000065.1. On Jun 1, 2021 this sequence version replaced NM_052981.3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC059109.1, AF154914.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-246 JACYVU010000065.1 8340334-8340579 247-369 JACYVU010000065.1 8341666-8341788 370-443 JACYVU010000065.1 8346776-8346849 444-654 JACYVU010000065.1 8347931-8348141 655-818 JACYVU010000065.1 8352779-8352942 819-889 JACYVU010000065.1 8355779-8355849 890-1001 JACYVU010000065.1 8359361-8359472 1002-1062 JACYVU010000065.1 8359822-8359882 1063-1230 JACYVU010000065.1 8360751-8360918 FEATURES Location/Qualifiers source 1..1230 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="2" /map="2q11" gene 1..1230 /gene="Ccnh" /note="cyclin H" /db_xref="GeneID:84389" /db_xref="RGD:69419" exon 1..246 /gene="Ccnh" /inference="alignment:Splign:2.1.0" CDS 130..1101 /gene="Ccnh" /codon_start=1 /product="cyclin-H" /protein_id="NP_443213.3" /db_xref="GeneID:84389" /db_xref="RGD:69419" /translation="
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPLFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPMLENPEILRKTADDFLSRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAILKQKLERCHSSDLALNMVTKKRKGYEDDDYVSKKPKQEEEEWTDDDLVDAL"
misc_feature 133..1053 /gene="Ccnh" /note="cyclin ccl1; Region: ccl1; TIGR00569" /db_xref="CDD:129660" misc_feature 142..144 /gene="Ccnh" /note="Phosphoserine, by CDK8. /evidence=ECO:0000250|UniProtKB:P51946; propagated from UniProtKB/Swiss-Prot (Q9R1A0.2); phosphorylation site" misc_feature 523..525 /gene="Ccnh" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P51946; propagated from UniProtKB/Swiss-Prot (Q9R1A0.2); phosphorylation site" misc_feature 1015..1098 /gene="Ccnh" /note="propagated from UniProtKB/Swiss-Prot (Q9R1A0.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 1039..1041 /gene="Ccnh" /note="Phosphoserine, by CDK8. /evidence=ECO:0000250|UniProtKB:P51946; propagated from UniProtKB/Swiss-Prot (Q9R1A0.2); phosphorylation site" misc_feature 1072..1074 /gene="Ccnh" /note="Phosphothreonine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (Q9R1A0.2); phosphorylation site" exon 247..369 /gene="Ccnh" /inference="alignment:Splign:2.1.0" exon 370..443 /gene="Ccnh" /inference="alignment:Splign:2.1.0" exon 444..654 /gene="Ccnh" /inference="alignment:Splign:2.1.0" exon 655..818 /gene="Ccnh" /inference="alignment:Splign:2.1.0" exon 819..889 /gene="Ccnh" /inference="alignment:Splign:2.1.0" exon 890..1001 /gene="Ccnh" /inference="alignment:Splign:2.1.0" exon 1002..1062 /gene="Ccnh" /inference="alignment:Splign:2.1.0" exon 1063..1230 /gene="Ccnh" /inference="alignment:Splign:2.1.0" ORIGIN
gtgaccgtgacgtcacgcgcgcgcctgcggtctgggccgagggttctcgcgttggcagtcgctcgtggctgctgtctcccggagtgtcgctgtttctgtctcggccctgcggcccgtgagggctacagcatgtaccacaacagcagccagaagcggcactggaccttcgctagcgaggagcaactggcgcgtctgcgggccgacgccaaccgcaaattcaagtgcaaagctgtggctaacgggaaggttcttccaaatgatccgttgtttcttgagcctcatgaagaaatgacactttgcaaatactatgaaaaaagattgttggaattttgttcagtgtttaaaccagctatgccacggtctgttgtgggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcaccctcggataataatgcttacttgtgcatttttggcctgcaaagtagatgaattcaatgtgtctagtcctcagtttgttgggaaccttcgagagagtcctcttggacaggagaaggcactggaacagattttggaatatgaactactacttatacaacaacttaattttcacctcattgtccacaatccatatagaccatttgaaggcttcctcattgatataaagactcgataccccatgttggagaatccagagattttgaggaaaacggctgatgattttcttagtagaattgcattgacagatgcttatcttttgtacacaccctcacaaattgccctgactgccattttatcaagtgcctctagggctggaattactatggaaagctatttatcagagagtctaatgctgaaagaaaacagaacttgcctgtcacagctactggatataatgaaaagcatgagaaatctagtaaaaaagtatgagccacccagatctgaagaagttgctattctgaaacagaagttggagcgatgtcattcttctgaccttgcacttaatatggttacaaagaagaggaaaggctacgaagacgatgactatgtatcaaagaaacccaaacaggaagaggaggagtggacggacgatgacctggtagatgctctctaaccagtgtaaatgactgcagcagtacttactgaccgacggaagtaggaagcatgtctgacattttacttttgtcaaaatagtgcaatgtgaaaacatcaaaatatattaaacttttctaattcttatata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]