GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-21 03:45:30, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001308636            1870 bp    mRNA    linear   ROD 21-MAR-2023
DEFINITION  Rattus norvegicus homeo box C10 (Hoxc10), mRNA.
ACCESSION   NM_001308636 XM_003750414 XM_003754360
VERSION     NM_001308636.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1870)
  AUTHORS   Kato H, Ario T, Kishida T, Tadano M, Osawa S, Maeda Y, Takakura H
            and Izawa T.
  TITLE     Homeobox A5 and C10 genes modulate adaptation of brown adipose
            tissue during exercise training in juvenile rats
  JOURNAL   Exp Physiol 106 (2), 463-474 (2021)
   PUBMED   33369800
  REMARK    GeneRIF: Homeobox A5 and C10 genes modulate adaptation of brown
            adipose tissue during exercise training in juvenile rats.
REFERENCE   2  (bases 1 to 1870)
  AUTHORS   Ng Y, Tan SX, Chia SY, Tan HY, Gun SY, Sun L, Hong W and Han W.
  TITLE     HOXC10 suppresses browning of white adipose tissues
  JOURNAL   Exp Mol Med 49 (2), e292 (2017)
   PUBMED   28186086
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1870)
  AUTHORS   Seki T, Shimokawa N, Iizuka H, Takagishi K and Koibuchi N.
  TITLE     Abnormalities of vertebral formation and Hox expression in
            congenital kyphoscoliotic rats
  JOURNAL   Mol Cell Biochem 312 (1-2), 193-199 (2008)
   PUBMED   18327665
REFERENCE   4  (bases 1 to 1870)
  AUTHORS   Wu Y, Wang G, Scott SA and Capecchi MR.
  TITLE     Hoxc10 and Hoxd10 regulate mouse columnar, divisional and motor
            pool identity of lumbar motoneurons
  JOURNAL   Development 135 (1), 171-182 (2008)
   PUBMED   18065432
REFERENCE   5  (bases 1 to 1870)
  AUTHORS   Wellik DM and Capecchi MR.
  TITLE     Hox10 and Hox11 genes are required to globally pattern the
            mammalian skeleton
  JOURNAL   Science 301 (5631), 363-367 (2003)
   PUBMED   12869760
REFERENCE   6  (bases 1 to 1870)
  AUTHORS   Sandrock B and Egly JM.
  TITLE     A yeast four-hybrid system identifies Cdk-activating kinase as a
            regulator of the XPD helicase, a subunit of transcription factor
            IIH
  JOURNAL   J Biol Chem 276 (38), 35328-35333 (2001)
   PUBMED   11445587
REFERENCE   7  (bases 1 to 1870)
  AUTHORS   de Stanchina E, Gabellini D, Norio P, Giacca M, Peverali FA, Riva
            S, Falaschi A and Biamonti G.
  TITLE     Selection of homeotic proteins for binding to a human DNA
            replication origin
  JOURNAL   J Mol Biol 299 (3), 667-680 (2000)
   PUBMED   10835276
REFERENCE   8  (bases 1 to 1870)
  AUTHORS   Iimura T, Oida S, Takeda K, Maruoka Y and Sasaki S.
  TITLE     Changes in homeobox-containing gene expression during ectopic bone
            formation induced by bone morphogenetic protein
  JOURNAL   Biochem Biophys Res Commun 201 (2), 980-987 (1994)
   PUBMED   7911662
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000187.1.
            
            On Feb 10, 2021 this sequence version replaced NM_001308636.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CK471575.1, BU758946.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760384, SAMEA5760386
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-751               JACYVU010000187.1  20838240-20838990
            752-1870            JACYVU010000187.1  20842347-20843465
FEATURES             Location/Qualifiers
     source          1..1870
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="7"
                     /map="7q36"
     gene            1..1870
                     /gene="Hoxc10"
                     /note="homeo box C10"
                     /db_xref="GeneID:315338"
                     /db_xref="RGD:1307250"
     CDS             1..1029
                     /gene="Hoxc10"
                     /note="Hox3.5 homeobox"
                     /codon_start=1
                     /product="homeobox protein Hox-C10"
                     /protein_id="NP_001295565.1"
                     /db_xref="GeneID:315338"
                     /db_xref="RGD:1307250"
                     /translation="
MTCPRNVTPNSYAEPLAAPGGGERYNRSAGMYMQSGSDFNCGVMRGCGLAPSLSKRDEGGSPNLALNTYPSYLSQLDSWGDPKAAYRLEQPVGRPLSSCSYPPSVKEENVCCMYSAEKRAKSGPEAALYSHPLPESCLGEHEVPVPSYYRASPSYSALDKTPHCAGANEFEAPFEQRASLNPRTEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLVGPKASPSESEKERAKTADSSPDTSDNEAKEEIKAENTTGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT"
     misc_feature    661..>993
                     /gene="Hoxc10"
                     /note="Homeodomain-containing transcription factor
                     [Transcription]; Region: COG5576"
                     /db_xref="CDD:227863"
     misc_feature    order(805..819,823..825,874..876,892..894,931..933,
                     937..942,949..954,958..966,970..975)
                     /gene="Hoxc10"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    811..972
                     /gene="Hoxc10"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(811..813,820..822,940..942,949..954,961..963)
                     /gene="Hoxc10"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            1..751
                     /gene="Hoxc10"
                     /inference="alignment:Splign:2.1.0"
     exon            752..1870
                     /gene="Hoxc10"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgacatgccctcgcaatgtaactccgaactcgtacgcggagcccttggctgcgccgggaggaggagagcgctataaccgtagcgcaggaatgtatatgcaatctgggagtgacttcaactgcggggtgatgaggggctgcgggcttgcgccctctctctccaagagggacgagggaggcagcccaaacctggccctcaacacctacccgtcctacctctcgcagctggactcctggggcgaccccaaagccgcctaccgcctggaacaacctgttggcaggcctctgtcctcctgttcctacccacctagtgtcaaggaggagaatgtctgctgcatgtacagtgcagagaagcgggcgaaaagtggccctgaggcagctctctactcccaccccctgccggagtcttgccttggggagcacgaggtacctgtacccagctactaccgcgccagcccgagctactccgcgctggacaaaacgccccactgtgctggggccaacgagtttgaagccccttttgagcagcgggccagtctcaacccgcgcaccgaacatctggaatcgcctcagcttgggggcaaagtgagttttcctgagacccccaagtccgacagccagacccccagtcccaacgagatcaagacggagcaaagcctggtgggcccaaaagccagcccctcggagagcgaaaaggaacgggccaagaccgcagactccagcccagacacctcggataatgaagctaaagaggagataaaggcagaaaacaccacaggaaattggctgacagcaaagagcggaaggaagaagaggtgcccctatactaaacaccagacgctggaattggagaaagaatttctgttcaatatgtatttgacgcgagagcgccgcctggagattagcaagaccattaaccttacagacagacaagtcaaaatctggtttcaaaatcgcagaatgaaactcaagaaaatgaaccgagagaatcggatccgggaactgacctccaattttaatttcacctgagccagcgtcatctcctcccccctccccttctctcctttccccgcccctcctccctttgtgcctggtgatatattttttcccctccctgagtataaatgcaatgcgcctgcaaaaaaaaaaaaaaaaaaaaaaaaaggcaaagacctcagactctccttccaagggacctatggttcgtgcttcgaggatgcttccacctaaagcatgaaaatggggtgctgggttttggggtgttgtgtgtgccctcatagacagggtggtagtgtggccggtgtgtgtgtcaactcctcagtcacccatgcacacacatgcagccttctgttctccatgcaaagttgaggtcaaatccacccaattataggggaaagaaagggggataaaatcagagagggtctgtaacctcgtagagcacagttagaattgctccctccttgctgcattccccctcttagaataatagatagtcttgaaagttcggctagtatttgtgtgtttgtcatagcacccagtgtctagactaaccctccctgtgtgtttccctcccaatggctctgagaatatgcttgaagtatttgtactgctttctgcttttctcccacccttcccaacacactgtatctctctctcttcctaacatctcagaaattccacacagaagaacaaaaacattaaaaaatagaacatagcaaagtaaaaacaaattccacccccaccccaagttgtcctgctcctgtctgggagttgtgttatttaaagataatctgtatgttgtatcttttgcatgtagcttccttaatggagaaaaaattcctaataaatttccggaatcttgatcctcaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]