2024-05-21 06:43:48, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001191663 1777 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus GS homeobox 1 (Gsx1), mRNA. ACCESSION NM_001191663 XM_221885 VERSION NM_001191663.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1777) AUTHORS Mizuguchi R, Kriks S, Cordes R, Gossler A, Ma Q and Goulding M. TITLE Ascl1 and Gsh1/2 control inhibitory and excitatory cell fate in spinal sensory interneurons JOURNAL Nat Neurosci 9 (6), 770-778 (2006) PUBMED 16715081 REFERENCE 2 (bases 1 to 1777) AUTHORS Mutsuga N, Iwasaki Y, Morishita M, Nomura A, Yamamori E, Yoshida M, Asai M, Ozaki N, Kambe F, Seo H, Oiso Y and Saito H. TITLE Homeobox protein Gsh-1-dependent regulation of the rat GHRH gene promoter JOURNAL Mol Endocrinol 15 (12), 2149-2156 (2001) PUBMED 11731616 REFERENCE 3 (bases 1 to 1777) AUTHORS Li H, Zeitler PS, Valerius MT, Small K and Potter SS. TITLE Gsh-1, an orphan Hox gene, is required for normal pituitary development JOURNAL EMBO J 15 (4), 714-724 (1996) PUBMED 8631293 REFERENCE 4 (bases 1 to 1777) AUTHORS Valerius MT, Li H, Stock JL, Weinstein M, Kaur S, Singh G and Potter SS. TITLE Gsh-1: a novel murine homeobox gene expressed in the central nervous system JOURNAL Dev Dyn 203 (3), 337-351 (1995) PUBMED 8589431 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000224.1. On Oct 27, 2022 this sequence version replaced NM_001191663.1. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMN12840115, SAMN12840131 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-603 JACYVU010000224.1 3848916-3849518 c 604-1777 JACYVU010000224.1 3847234-3848407 c FEATURES Location/Qualifiers source 1..1777 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="12" /map="12p11" gene 1..1777 /gene="Gsx1" /gene_synonym="Gsh1" /note="GS homeobox 1" /db_xref="GeneID:288457" /db_xref="RGD:1310020" exon 1..603 /gene="Gsx1" /gene_synonym="Gsh1" /inference="alignment:Splign:2.1.0" CDS 195..980 /gene="Gsx1" /gene_synonym="Gsh1" /note="genomic screened homeo box 1" /codon_start=1 /product="GS homeobox 1" /protein_id="NP_001178592.1" /db_xref="GeneID:288457" /db_xref="RGD:1310020" /translation="
MPRSFLVDSLVLREASDKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSVSPGVAHSPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGAGAGAGGGAPQGCKCSSLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP"
misc_feature order(633..647,651..653,702..704,720..722,759..761, 765..770,777..782,786..794,798..803) /gene="Gsx1" /gene_synonym="Gsh1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(639..641,648..650,768..770,777..782,789..791) /gene="Gsx1" /gene_synonym="Gsh1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 642..800 /gene="Gsx1" /gene_synonym="Gsh1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" exon 604..1777 /gene="Gsx1" /gene_synonym="Gsh1" /inference="alignment:Splign:2.1.0" ORIGIN
ccagcacctcgcgcgctccgggcggcgcccgcagcagcagccaaggtgattccagccccggcttgagccgcgcgtggagcctcccggacccgggaaactgcgggtggccgcggcagagggaggccactgcagaatccgcagttccctcgggcgccaggggcgggctggcagcaggtggaccgcgcgccggagccatgccgcgctctttcctggtggattcccttgtgctgcgggaagccagcgacaagaaggctccggagggcagcccgccaccgctcttcccctacgcggtccccccgccgcacgcgctccacggcctctcgccgggcgcctgccacgcgcgcaaggccggcttgctgtgcgtgtgtcccctctgtgtcaccgcttcgcagctgcacgggccccccgggccgccggcgctgccgctactcaaggcgtccttccctcccttcggatcgcagtactgccacgcacccctgggccgccagcactctgtgtctcccggagtcgcccacagcccggccgcggctgcagcagctgccgcactctaccagacctcctacccgctgccggatcccagacagtttcactgcatctccgtggacagcagctcgaaccagctgcccagcagtaagaggatgcggacggcgttcaccagcacgcagctcctggagctggagcgcgagttcgcctccaacatgtacctctcccgcctgcggcgcatcgagatcgcgacctatctgaatctgtccgagaagcaggtgaagatctggtttcagaaccgccgggtgaagcacaagaaagaaggcaagggcagtaaccaccgcggcggagctggggcgggggccggcgggggcgcaccgcaaggctgcaagtgctcttcgctctcctcagccaaatgctcagaggatgacgacgaattgcccatgtctccatcttcctccgggaaggatgacagagatctcacagtcactccgtaggtgcgccttttagaggaccattggtccccccccttccccggcccttcccacacttcaaagactggttcttaggctccggctgccaatcaatggatggggagggctttgcggtggtgcacagctctaggcagagctgagaccttagcagagacttgaagcccttgtcactagggcttcagggtgtttaggaggactccaaatggtgaacgctgggtcctcctcccaggacacagcttcttctccccccccaggcacgcaggccggagaacagcgccttgctgaccgccggcgcctcctcgccgctaactctggactggttcaggcttcctctatcccacaaccctctcttcctcggtcaagctgggctttttcactccgctagtggctatttgctttccttttaacattttttcttgttctcactcccccacagccccccccgtggtcgtttatgcaacgcgtttgttacccccccccccacacacacacacactccggaagcctcttccttctgtctgtttgtcccttaaacagggaccaggtcttgctgttcgaagaagtccccttagcagagaggactgtctcaaatggtattgtattgggggaaatgactgtttccaacactctccaccccctttcaaatgaagccgctgtaaacaacctctcccccatcgtccaggtcccgaccccttctggggactgactgactgtgttgttgtatggtctctgtaatgccagaagatatttatttatttatttatgtacaaaattttaaataaacttttttttcttagaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]