GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-21 00:04:31, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001109143             745 bp    mRNA    linear   ROD 23-MAR-2023
DEFINITION  Rattus norvegicus claudin domain containing 2 (Cldnd2), mRNA.
ACCESSION   NM_001109143 XM_001080337 XM_574434
VERSION     NM_001109143.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 745)
  AUTHORS   Gaudet P, Livstone MS, Lewis SE and Thomas PD.
  TITLE     Phylogenetic-based propagation of functional annotations within the
            Gene Ontology consortium
  JOURNAL   Brief Bioinform 12 (5), 449-462 (2011)
   PUBMED   21873635
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473979.2.
            
            On or before Oct 4, 2007 this sequence version replaced
            XM_001080337.1, XM_574434.2.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA5760383,
                              SAMEA5760389 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..745
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q22"
     gene            1..745
                     /gene="Cldnd2"
                     /gene_synonym="RGD1566413"
                     /note="claudin domain containing 2"
                     /db_xref="GeneID:499140"
                     /db_xref="RGD:1566413"
     exon            1..105
                     /gene="Cldnd2"
                     /gene_synonym="RGD1566413"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    2..4
                     /gene="Cldnd2"
                     /gene_synonym="RGD1566413"
                     /note="upstream in-frame stop codon"
     exon            106..287
                     /gene="Cldnd2"
                     /gene_synonym="RGD1566413"
                     /inference="alignment:Splign:2.1.0"
     CDS             119..622
                     /gene="Cldnd2"
                     /gene_synonym="RGD1566413"
                     /codon_start=1
                     /product="claudin domain-containing protein 2"
                     /protein_id="NP_001102613.1"
                     /db_xref="GeneID:499140"
                     /db_xref="RGD:1566413"
                     /translation="
MGVKKSLQTGGNLLNLLSSVLTVLSTTTSYWIRQQGGHSGLWQECTHGVCSNMPCQNTLAVTTACMVLAAAFSIVALGMGIRIQCQEAESLRSQNTIVLLFLSGLLLLIALTVYTAKNAWKPEVFFSWSYFFGWLALPFSFIAGFCFLLADMIMQSTEAISGFPVCL"
     misc_feature    185..550
                     /gene="Cldnd2"
                     /gene_synonym="RGD1566413"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
     exon            288..428
                     /gene="Cldnd2"
                     /gene_synonym="RGD1566413"
                     /inference="alignment:Splign:2.1.0"
     exon            429..548
                     /gene="Cldnd2"
                     /gene_synonym="RGD1566413"
                     /inference="alignment:Splign:2.1.0"
     exon            549..745
                     /gene="Cldnd2"
                     /gene_synonym="RGD1566413"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ttaaaaggctgctaggggagagggttctggaatctctgcggcctcacagagaaccatcctcccttcccccaaccccgtgggctctctgtcccaggggaccaggctctgcctccttggcatgggggtgaagaagagccttcagactggaggcaatttgcttaatctcttgagcagcgtcctcacagtactatccactactaccagctactggatccgacaacaagggggacacagtggcctatggcaggagtgtacccatggcgtctgctccaacatgccctgccagaacaccttggcagtgaccacagcatgcatggtgctggcagcagccttcagtatcgtagctttggggatggggataaggattcagtgtcaagaggccgagtcactacgtagccaaaataccattgtcttactttttctcagcgggctgctgctgctgattgcattgaccgtatacactgcaaagaatgcctggaagccagaagtcttcttctcctggtcctactttttcggatggttggctttacccttctcgtttattgcgggcttctgctttctgcttgccgacatgatcatgcagagcaccgaagccatcagcgggttcccagtgtgcctgtgaatgcggcctgcctggggcagaataaaggaatggcttttagcatcgtccctgcgtgcttttctgcggaacgtagagacataagcttgaagactacagggacacggataaagtgacttgtagaga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]