GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-21 03:48:20, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001024901             772 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus Rhox homeobox family member 12 (Rhox12), mRNA.
ACCESSION   NM_001024901 XM_343757
VERSION     NM_001024901.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 772)
  AUTHORS   Gaudet P, Livstone MS, Lewis SE and Thomas PD.
  TITLE     Phylogenetic-based propagation of functional annotations within the
            Gene Ontology consortium
  JOURNAL   Brief Bioinform 12 (5), 449-462 (2011)
   PUBMED   21873635
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from DQ058659.1.
            
            On Jun 17, 2005 this sequence version replaced XM_343757.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: DQ058659.1, CD372930.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760434 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..772
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /map="Xq35"
     gene            1..772
                     /gene="Rhox12"
                     /note="Rhox homeobox family member 12"
                     /db_xref="GeneID:363437"
                     /db_xref="RGD:1563789"
     exon            1..144
                     /gene="Rhox12"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    120..122
                     /gene="Rhox12"
                     /note="upstream in-frame stop codon"
     exon            145..553
                     /gene="Rhox12"
                     /inference="alignment:Splign:2.1.0"
     CDS             153..680
                     /gene="Rhox12"
                     /note="reproductive homeobox on X chromosome 12;
                     reproductive homeobox 12"
                     /codon_start=1
                     /product="Rhox homeobox family member 12"
                     /protein_id="NP_001020072.1"
                     /db_xref="GeneID:363437"
                     /db_xref="RGD:1563789"
                     /translation="
MALQSHHVEPSSYKLEENEIEVSLDADEAAEGGSFGEGSLNGSDKLKYEGIPDKDDRIYVGDVKYIGNDVKDEYRGSHQGSGDSQLEEQKNLASPTIPQFRRTRPRIQLGLTPRQLSELEDFFETTKYPDVITRRNLAKHLYLAESRVKRWFKRRRARYRKEQQTQMLKRASADR"
     misc_feature    453..641
                     /gene="Rhox12"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(453..467,483..485,534..536,552..554,591..593,
                     597..602,609..614,618..626,630..635)
                     /gene="Rhox12"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(459..461,468..470,600..602,609..614,621..623)
                     /gene="Rhox12"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            554..599
                     /gene="Rhox12"
                     /inference="alignment:Splign:2.1.0"
     exon            600..772
                     /gene="Rhox12"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
acctgttgagctgcctgcaggccgtagagtgtgcgttgggtttctagattttatgagccatcactcaggctgagatagactttggtgacgaagctgtctttgagtcatctctgctcctgtaagcaacccctcgcccatattcctattccaccatggctctccaatcccatcatgtggagcccagttcctacaaactggaggaaaatgagatcgaggtgagccttgatgctgatgaagcagcagagggaggcagcttcggagaaggttctctaaatggctcagacaaactaaagtacgagggcatcccagacaaggatgataggatctacgttggagacgtgaagtacattggtaatgacgtcaaagatgagtaccgtgggagccaccaagggtccggagattcacagctggaggagcagaagaacttggcttctcccacaatcccacagttccggcgcacaaggccacggatccagttgggtctcacgcccaggcagctgagtgaactggaagacttttttgaaactactaagtacccggatgtgatcacgagaagaaacctcgcaaagcacttgtacctggcagaatccagagtgaagagatggtttaagagaagaagagccagatacaggaaagaacagcagactcaaatgctcaagcgagcatctgctgataggtagaagaatgccatgcaacaaagcttttggaggagtcctgaagcatcttcctgtccaggcatcagatgaaggcacgttaggcactaatactcccc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]