2024-05-07 11:34:05, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_039104732 5180 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus vav guanine nucleotide exchange factor 2 (Vav2), transcript variant X4, mRNA. ACCESSION XM_039104732 VERSION XM_039104732.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_051338.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_015227675.2-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/06/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..5180 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /db_xref="taxon:10116" /chromosome="3" /sex="male" /tissue_type="kidney" /country="USA: Wisconsin, Milwaukee, Medical College of Wisconsin" /collection_date="2019-03-08" /collected_by="Rebecca Schilling" gene 1..5180 /gene="Vav2" /note="vav guanine nucleotide exchange factor 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 27 ESTs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 75 samples with support for all annotated introns" /db_xref="GeneID:296603" /db_xref="RGD:1306285" CDS 549..3098 /gene="Vav2" /codon_start=1 /product="guanine nucleotide exchange factor VAV2 isoform X4" /protein_id="XP_038960660.1" /db_xref="GeneID:296603" /db_xref="RGD:1306285" /translation="
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSIAQSKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEVQQPMIRYMQKMGLTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMGPLRQVLSPVDMATIFINLEDLIKVHHSFLRAIDVSMMAGGSTLAKVFLEFKERLLIYGEYCSHMEHAQSALNQLLASRDDFRQKVEECTLKVQEGKFKLQDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLKEALEAMQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHNKDIKKSHGKMWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYLCTRCGVGAHKECLEVIPPCKMSSPADADAPGAGLGPKMVAVQNYHGNPAPPGKPVLTFQTGDVIELLRGDPDSPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPVGRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKFPYKSRERAATRASSRSPVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ"
misc_feature 552..908 /gene="Vav2" /note="calponin homology (CH) domain found in VAV2 protein and similar proteins; Region: CH_VAV2; cd21263" /db_xref="CDD:409112" misc_feature order(555..557,567..569,756..758,762..767,774..779, 783..785,816..842,858..860,864..869,873..878,885..890, 897..899) /gene="Vav2" /note="putative actin binding site [polypeptide binding]; other site" /db_xref="CDD:409112" misc_feature 1143..1670 /gene="Vav2" /note="Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain. It appears that PH domains invariably occur C-terminal to RhoGEF/DH domains; Region: RhoGEF; cd00160" /db_xref="CDD:238091" misc_feature order(1161..1163,1173..1175,1440..1442,1524..1529, 1536..1541,1545..1550,1557..1562,1569..1574,1581..1583, 1656..1658,1668..1670) /gene="Vav2" /note="GTPase interaction site [polypeptide binding]; other site" /db_xref="CDD:238091" misc_feature 1713..2096 /gene="Vav2" /note="Vav pleckstrin homology (PH) domain; Region: PH_Vav; cd01223" /db_xref="CDD:269930" misc_feature 2103..2276 /gene="Vav2" /note="protein kinase C conserved region 1 (C1 domain) found in VAV2 protein; Region: C1_VAV2; cd20868" /db_xref="CDD:410418" misc_feature 2316..2495 /gene="Vav2" /note="First Src homology 3 domain of VAV2 protein; Region: SH3_VAV2_1; cd11980" /db_xref="CDD:212913" misc_feature order(2331..2333,2337..2339,2346..2348,2370..2372, 2427..2432,2475..2477,2481..2486) /gene="Vav2" /note="peptide ligand binding site [polypeptide binding]; other site" /db_xref="CDD:212913" misc_feature 2547..2855 /gene="Vav2" /note="Src homology 2 (SH2) domain found in the Vav2 proteins; Region: SH2_Vav2; cd10406" /db_xref="CDD:198269" misc_feature order(2586..2588,2640..2642,2703..2705,2709..2711) /gene="Vav2" /note="phosphotyrosine binding pocket [polypeptide binding]; other site" /db_xref="CDD:198269" misc_feature order(2706..2708,2787..2789) /gene="Vav2" /note="hydrophobic binding pocket [polypeptide binding]; other site" /db_xref="CDD:198269" misc_feature 2916..3089 /gene="Vav2" /note="C-terminal (or second) Src homology 3 domain of VAV2 protein; Region: SH3_VAV2_2; cd11977" /db_xref="CDD:212910" misc_feature order(2934..2936,2940..2942,2949..2951,2961..2963, 3021..3026,3063..3065,3069..3074) /gene="Vav2" /note="peptide ligand binding site [polypeptide binding]; other site" /db_xref="CDD:212910" ORIGIN
tggagccgcggagcctcggagtcccagtgccccgcgagtagcgtagagcccgcgggcccggcgaacaaagcgacggtggggcgagtagctcaggcgccggacgcagggaccgagcgacccgctgcgcctttgtctcgggtggggcaggagcggcggccggagcggggcgccccgaacgcagaatgcggcgcccagaggggcggatcgaagagcgctgcggcggcaggaggtgtggagcccgggccggagcccgagcgcacttgtgtgtgtgaaggggggacccggcacactgccccgagagcgcctagtggccgcacgtgggcgggagccgcggcccgctagtagcccgaggaggaggaggaggaagaggagggccgtgtggccgcgcagcggggacccggggccgcctgcgcgaagccccgccccggcggccgagccccgcgcgggcggtcgggatgctccgcggtcaccgcactttggccggagcgctgccctgagccagctggcccagcggccgcggcggcgagcgcacgggcgccgcgggcgccatggagcagtggcggcaatgcggccgctggctcattgactgcaaggtcctgccgcccaaccaccgcgtcgtgtggccctcggcggtggtcttcgacctggcgcaggcgctgcgcgacggcgtccttctgtgccagctgctgcacaacctctcccccggctccatcgaccttaaggacatcaacttccggccgcagatgtcccagttcctgtgtctgaagaatattcgcaccttcctcaaagtctgccacgacaaatttggactaaggaacagtgagctgtttgaccctttcgacctctttgatgtccgagacttcgggaaggtcatctctgccgtgtcccgtctgtccctgcacagcatcgcgcagagcaaagggatcaggccttttccatcagaggagacggctgaaaacgatgacgatgtctaccggagtctggaagagctggctgacgagcatgacctgggtgaggacatctacgactgtgtcccgtgtgaagatgaaggagatgacatttatgaggacatcatcaaggtggaggtgcagcagcccatgatcagatacatgcagaaaatgggactaaccgaggacgacaagaggagctgctgcttgttagagattcaggagaccgaggccaagtactaccgcaccctggaggacattgagaagaactacatgggtcccttgcggcaggtgctgagccccgtggacatggccaccatcttcatcaacctggaggacctcatcaaggtgcaccacagctttctgcgagccatcgatgtgtccatgatggctggtggcagtaccctggctaaggtcttcctggagtttaaggaacggctcctgatctacggagagtactgtagccacatggagcatgcgcagagcgcactgaaccagctcctcgccagccgagacgacttcaggcagaaagtggaggagtgcacactcaaggtccaggagggcaagttcaagctgcaggatctgctggtggtgcccatgcagcgggtgctcaagtaccacctgttgctcaaggagctcctgagccattccgcagaccggcctgaaagacaacagctcaaagaagcactggaagccatgcaggacttggccatgtatattaatgaagtgaaacgggacaaggagaccttgaagaagattagtgagttccagtgctccatagaaaacctgcaagtgaagctggaggaatttgggaggccgaagattgacggggagctgaaagttcggtccatagtcaaccacaccaagcaagacaggtacctgttcctgtttgacaaggtggtcatcgtgtgtaagaggaagggctacagctatgagctgaaggaggttattgaactgctcttccacaagatgactgatgaccccatgcacaacaaagacatcaagaagtctcatgggaagatgtggtcctatggcttctacctgattcacctccaagggaagcaaggctttcagttcttctgcaagacggaagacatgaaacggaagtggatggagcagttcgagatggccatgtcaaacatcaagccagacaaggccaatgccaaccatcatagtttccagatgtacacgtttgacaagaccaccaactgcaaagcctgcaagatgttcctcaggggtaccttctaccagggatacctgtgtaccagatgtggtgtcggggcacacaaggagtgcctggaggtgatacccccctgcaagatgagttcgcctgcagatgcggacgctcccggagcaggactaggtcccaagatggttgccgtgcagaattaccatggtaacccagcccctcccgggaagcccgtgttgaccttccagacaggggatgtgatagagctgctccggggtgaccccgattctccttggtgggaggggaggctggttcaaactcggaagtcagggtatttccccagctcatctgtgaagccctgcccggtggacggaaggccgcctgttggccgcccgccatcccgggagatcgattacactgcatacccgtggttcgctggcaacatggaacggcagcagacggacaatctactcaagtctcatgccagcgggacctacctcatcagagagcgcccagcagaggcagagcgtttcgccatcagcatcaagttcaatgatgaagtgaaacacatcaaggtggtggaaaaagacagctggatccacatcacggaagctaagaagtttgagagcctcctggagctggtggagtactaccagtgccactcacttaaggagagcttcaagcagttagacactacactcaagttcccctacaagtctcgggagcgcgccgccaccagggcctcaagccgatctccagtgttcacaccgcgggtcatcggcacagccgtggccaggtacaactttgctgcacgagacatgcgggagctgtcgctgcgggaaggtgatgtggtgaagatctacagccggatcggtggggaccagggctggtggaagggcgagacgaacgggcggatcggttggtttccttcgacgtacgtggaagaggaaggcatccagtgagggcgagacctggacagaacccacagatgctcttgggagtctccccagctctgaagtccgcctctggcttctccgtagctctgggaactgcctgctaagcctgcagctgttatggcccctagggatggggagggtgtcccaccatcacctgccctaggtggcctgtgcctgggtacattccttgtacatagaggagatccgtgctggccacacccagagcaccaaggatggggagctcaggccatatggccaagcatgtgtggatgacagcaaaggtcagaagctactgcctgcccctctggtttagatggttgctcaggagcccagacttcgactcatggtgtgccagggagggctggggacaacagggggtcccttcccaggcccatctgctgccccacactgatctgcctgtcttttctgctgctctctagagtgtgtgtcaggttttgggaggcaggcaggaccagagccaagctgtgctgtagcacactccaggcccagctgggagagagcttgcacaggggccgctggatcacgctagctctggagatttccctggctgcctcccttcctgacacagcagggtcctgctgcgtgctaactgggcaggcccctccctcatgagggaccttcggaccgatgacattgctgacccatccccagcccacccagtcagtggtactgctctttgcttgttgaagcccctttcctgagccaggaaacaggtcttttctgccctgctgccaggggggacacatctgtgaacctcgaagagcagggtagaaaaccaggttcccctccctgctcgctgtctcttttctctccgggaggcactcttgggtcttctgcactctaaaccatgctcactaggagtctgctggcctttgcactagatgttagtttgagcccttgtctggtatcccacaaggattcctgcaacccacacactgggcttatggccagctcaaaataagtgctcttgggggtctctgccctttcacttcttctcctggtgcttcctggcctttgacctctgcttgcttggccaaccctcttttcacccggtggagttctgagtggaagcttatgtgaagacacacacacagactcttgggccctttctcccctcatccagctgcccattcctggatgagtaggagccaaggttagggacactgtcccactgtcccactgtccccaacggagtggataatgcactacttgctcctggggacactttccagagttggcttatgtcctccagcttggtgtccacatataacatgctaggatgttaggggaggcagagagggattcggagaaggggagcagcaggaagagagagaccttggaaagcctcagctatgagaaactgggagtgaagggtttggagagggccggggcgcgggccacctacactgctccttggcccagcctgcccagtgcaagtgcagaccttggggagggctctgtcggcaggagccatacgaacgccctcacgtcagtcacgacaccctgtgctttaggttttgtttcgtttgtttgtttttctgttgtagctttttttccttttttgtcctgttacattttgttttgcctgttcgtatcttagaaggggggaaagttgtaattatttcatctaaatctcccattatatatctgtgaataagagattctatgatagcagaaggatgtatattttagcttgtcatgacgtgtcatgataacgaaggacactgagaaagaggatagtccagagccccgttcttgtgaatgttttgtgtttgttttgacatgtgtgtttggtttgggtttttttgtttttgttgtttttgagctgcactgagcagggtgctgggcaggctggggcatgggcacctctgcaggagactggacaccgactaaggactgggggcctgagatcagctgtgaacatttgcagcacaatgcatgcaagtcagggatgtgggggtcccacagccagcagcaccccctgatggaacaactgtacatttgccaatgggttttccccacaagactacggtttttactacaaataaacttacgttctattctgca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]