LOCUS       XM_039104730            5269 bp    mRNA    linear   ROD 11-JUN-2023
DEFINITION  PREDICTED: Rattus norvegicus vav guanine nucleotide exchange factor
            2 (Vav2), transcript variant X1, mRNA.
ACCESSION   XM_039104730
VERSION     XM_039104730.1
DBLINK      BioProject: PRJNA677964
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051338.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_015227675.2-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/06/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..5269
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /db_xref="taxon:10116"
                     /chromosome="3"
                     /sex="male"
                     /tissue_type="kidney"
                     /country="USA: Wisconsin, Milwaukee, Medical College of
                     Wisconsin"
                     /collection_date="2019-03-08"
                     /collected_by="Rebecca Schilling"
     gene            1..5269
                     /gene="Vav2"
                     /note="vav guanine nucleotide exchange factor 2; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 26 ESTs, 3 Proteins, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     35 samples with support for all annotated introns"
                     /db_xref="GeneID:296603"
                     /db_xref="RGD:1306285"
     CDS             551..3187
                     /gene="Vav2"
                     /codon_start=1
                     /product="guanine nucleotide exchange factor VAV2 isoform
                     X1"
                     /protein_id="XP_038960658.1"
                     /db_xref="GeneID:296603"
                     /db_xref="RGD:1306285"
                     /translation="

MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSIAQSKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEVQQPMIRYMQKMGLTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMGPLRQVLSPVDMATIFINLEDLIKVHHSFLRAIDVSMMAGGSTLAKVFLEFKERLLIYGEYCSHMEHAQSALNQLLASRDDFRQKVEECTLKVQEGKFKLQDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLKEALEAMQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHNKDIKKSHGKMWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYLCTRCGVGAHKECLEVIPPCKMSSPADADAPGAGLGPKMVAVQNYHGNPAPPGKPVLTFQTGDVIELLRGDPDSPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPVGRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKFPYKSRERAATRASSRSPASCASYSFSFLSPQGLSFAPQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ"

     misc_feature    554..910
                     /gene="Vav2"
                     /note="calponin homology (CH) domain found in VAV2 protein
                     and similar proteins; Region: CH_VAV2; cd21263"
                     /db_xref="CDD:409112"
     misc_feature    order(557..559,569..571,758..760,764..769,776..781,
                     785..787,818..844,860..862,866..871,875..880,887..892,
                     899..901)
                     /gene="Vav2"
                     /note="putative actin binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:409112"
     misc_feature    1145..1672
                     /gene="Vav2"
                     /note="Guanine nucleotide exchange factor for
                     Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous
                     (DH) domain. It appears that PH domains invariably occur
                     C-terminal to RhoGEF/DH domains; Region: RhoGEF; cd00160"
                     /db_xref="CDD:238091"
     misc_feature    order(1163..1165,1175..1177,1442..1444,1526..1531,
                     1538..1543,1547..1552,1559..1564,1571..1576,1583..1585,
                     1658..1660,1670..1672)
                     /gene="Vav2"
                     /note="GTPase interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:238091"
     misc_feature    1715..2098
                     /gene="Vav2"
                     /note="Vav pleckstrin homology (PH) domain; Region:
                     PH_Vav; cd01223"
                     /db_xref="CDD:269930"
     misc_feature    2105..2278
                     /gene="Vav2"
                     /note="protein kinase C conserved region 1 (C1 domain)
                     found in VAV2 protein; Region: C1_VAV2; cd20868"
                     /db_xref="CDD:410418"
     misc_feature    order(2120..2122,2159..2161,2168..2170,2210..2212,
                     2219..2221,2234..2236,2243..2245,2264..2266)
                     /gene="Vav2"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:410418"
     misc_feature    2318..2497
                     /gene="Vav2"
                     /note="First Src homology 3 domain of VAV2 protein;
                     Region: SH3_VAV2_1; cd11980"
                     /db_xref="CDD:212913"
     misc_feature    order(2333..2335,2339..2341,2348..2350,2372..2374,
                     2429..2434,2477..2479,2483..2488)
                     /gene="Vav2"
                     /note="peptide ligand binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:212913"
     misc_feature    2549..2857
                     /gene="Vav2"
                     /note="Src homology 2 (SH2) domain found in the Vav2
                     proteins; Region: SH2_Vav2; cd10406"
                     /db_xref="CDD:198269"
     misc_feature    order(2588..2590,2642..2644,2705..2707,2711..2713)
                     /gene="Vav2"
                     /note="phosphotyrosine binding pocket [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198269"
     misc_feature    order(2708..2710,2789..2791)
                     /gene="Vav2"
                     /note="hydrophobic binding pocket [polypeptide binding];
                     other site"
                     /db_xref="CDD:198269"
     misc_feature    3005..3178
                     /gene="Vav2"
                     /note="C-terminal (or second) Src homology 3 domain of
                     VAV2 protein; Region: SH3_VAV2_2; cd11977"
                     /db_xref="CDD:212910"
     misc_feature    order(3023..3025,3029..3031,3038..3040,3050..3052,
                     3110..3115,3152..3154,3158..3163)
                     /gene="Vav2"
                     /note="peptide ligand binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:212910"
ORIGIN      

cctggagccgcggagcctcggagtcccagtgccccgcgagtagcgtagagcccgcgggcccggcgaacaaagcgacggtggggcgagtagctcaggcgccggacgcagggaccgagcgacccgctgcgcctttgtctcgggtggggcaggagcggcggccggagcggggcgccccgaacgcagaatgcggcgcccagaggggcggatcgaagagcgctgcggcggcaggaggtgtggagcccgggccggagcccgagcgcacttgtgtgtgtgaaggggggacccggcacactgccccgagagcgcctagtggccgcacgtgggcgggagccgcggcccgctagtagcccgaggaggaggaggaggaagaggagggccgtgtggccgcgcagcggggacccggggccgcctgcgcgaagccccgccccggcggccgagccccgcgcgggcggtcgggatgctccgcggtcaccgcactttggccggagcgctgccctgagccagctggcccagcggccgcggcggcgagcgcacgggcgccgcgggcgccatggagcagtggcggcaatgcggccgctggctcattgactgcaaggtcctgccgcccaaccaccgcgtcgtgtggccctcggcggtggtcttcgacctggcgcaggcgctgcgcgacggcgtccttctgtgccagctgctgcacaacctctcccccggctccatcgaccttaaggacatcaacttccggccgcagatgtcccagttcctgtgtctgaagaatattcgcaccttcctcaaagtctgccacgacaaatttggactaaggaacagtgagctgtttgaccctttcgacctctttgatgtccgagacttcgggaaggtcatctctgccgtgtcccgtctgtccctgcacagcatcgcgcagagcaaagggatcaggccttttccatcagaggagacggctgaaaacgatgacgatgtctaccggagtctggaagagctggctgacgagcatgacctgggtgaggacatctacgactgtgtcccgtgtgaagatgaaggagatgacatttatgaggacatcatcaaggtggaggtgcagcagcccatgatcagatacatgcagaaaatgggactaaccgaggacgacaagaggagctgctgcttgttagagattcaggagaccgaggccaagtactaccgcaccctggaggacattgagaagaactacatgggtcccttgcggcaggtgctgagccccgtggacatggccaccatcttcatcaacctggaggacctcatcaaggtgcaccacagctttctgcgagccatcgatgtgtccatgatggctggtggcagtaccctggctaaggtcttcctggagtttaaggaacggctcctgatctacggagagtactgtagccacatggagcatgcgcagagcgcactgaaccagctcctcgccagccgagacgacttcaggcagaaagtggaggagtgcacactcaaggtccaggagggcaagttcaagctgcaggatctgctggtggtgcccatgcagcgggtgctcaagtaccacctgttgctcaaggagctcctgagccattccgcagaccggcctgaaagacaacagctcaaagaagcactggaagccatgcaggacttggccatgtatattaatgaagtgaaacgggacaaggagaccttgaagaagattagtgagttccagtgctccatagaaaacctgcaagtgaagctggaggaatttgggaggccgaagattgacggggagctgaaagttcggtccatagtcaaccacaccaagcaagacaggtacctgttcctgtttgacaaggtggtcatcgtgtgtaagaggaagggctacagctatgagctgaaggaggttattgaactgctcttccacaagatgactgatgaccccatgcacaacaaagacatcaagaagtctcatgggaagatgtggtcctatggcttctacctgattcacctccaagggaagcaaggctttcagttcttctgcaagacggaagacatgaaacggaagtggatggagcagttcgagatggccatgtcaaacatcaagccagacaaggccaatgccaaccatcatagtttccagatgtacacgtttgacaagaccaccaactgcaaagcctgcaagatgttcctcaggggtaccttctaccagggatacctgtgtaccagatgtggtgtcggggcacacaaggagtgcctggaggtgatacccccctgcaagatgagttcgcctgcagatgcggacgctcccggagcaggactaggtcccaagatggttgccgtgcagaattaccatggtaacccagcccctcccgggaagcccgtgttgaccttccagacaggggatgtgatagagctgctccggggtgaccccgattctccttggtgggaggggaggctggttcaaactcggaagtcagggtatttccccagctcatctgtgaagccctgcccggtggacggaaggccgcctgttggccgcccgccatcccgggagatcgattacactgcatacccgtggttcgctggcaacatggaacggcagcagacggacaatctactcaagtctcatgccagcgggacctacctcatcagagagcgcccagcagaggcagagcgtttcgccatcagcatcaagttcaatgatgaagtgaaacacatcaaggtggtggaaaaagacagctggatccacatcacggaagctaagaagtttgagagcctcctggagctggtggagtactaccagtgccactcacttaaggagagcttcaagcagttagacactacactcaagttcccctacaagtctcgggagcgcgccgccaccagggcctcaagccgatctccagcttcgtgtgcttcctacagcttttcttttctcagtcctcagggcctcagctttgccccccagggcccctctgctcccttctggtcagtgttcacaccgcgggtcatcggcacagccgtggccaggtacaactttgctgcacgagacatgcgggagctgtcgctgcgggaaggtgatgtggtgaagatctacagccggatcggtggggaccagggctggtggaagggcgagacgaacgggcggatcggttggtttccttcgacgtacgtggaagaggaaggcatccagtgagggcgagacctggacagaacccacagatgctcttgggagtctccccagctctgaagtccgcctctggcttctccgtagctctgggaactgcctgctaagcctgcagctgttatggcccctagggatggggagggtgtcccaccatcacctgccctaggtggcctgtgcctgggtacattccttgtacatagaggagatccgtgctggccacacccagagcaccaaggatggggagctcaggccatatggccaagcatgtgtggatgacagcaaaggtcagaagctactgcctgcccctctggtttagatggttgctcaggagcccagacttcgactcatggtgtgccagggagggctggggacaacagggggtcccttcccaggcccatctgctgccccacactgatctgcctgtcttttctgctgctctctagagtgtgtgtcaggttttgggaggcaggcaggaccagagccaagctgtgctgtagcacactccaggcccagctgggagagagcttgcacaggggccgctggatcacgctagctctggagatttccctggctgcctcccttcctgacacagcagggtcctgctgcgtgctaactgggcaggcccctccctcatgagggaccttcggaccgatgacattgctgacccatccccagcccacccagtcagtggtactgctctttgcttgttgaagcccctttcctgagccaggaaacaggtcttttctgccctgctgccaggggggacacatctgtgaacctcgaagagcagggtagaaaaccaggttcccctccctgctcgctgtctcttttctctccgggaggcactcttgggtcttctgcactctaaaccatgctcactaggagtctgctggcctttgcactagatgttagtttgagcccttgtctggtatcccacaaggattcctgcaacccacacactgggcttatggccagctcaaaataagtgctcttgggggtctctgccctttcacttcttctcctggtgcttcctggcctttgacctctgcttgcttggccaaccctcttttcacccggtggagttctgagtggaagcttatgtgaagacacacacacagactcttgggccctttctcccctcatccagctgcccattcctggatgagtaggagccaaggttagggacactgtcccactgtcccactgtccccaacggagtggataatgcactacttgctcctggggacactttccagagttggcttatgtcctccagcttggtgtccacatataacatgctaggatgttaggggaggcagagagggattcggagaaggggagcagcaggaagagagagaccttggaaagcctcagctatgagaaactgggagtgaagggtttggagagggccggggcgcgggccacctacactgctccttggcccagcctgcccagtgcaagtgcagaccttggggagggctctgtcggcaggagccatacgaacgccctcacgtcagtcacgacaccctgtgctttaggttttgtttcgtttgtttgtttttctgttgtagctttttttccttttttgtcctgttacattttgttttgcctgttcgtatcttagaaggggggaaagttgtaattatttcatctaaatctcccattatatatctgtgaataagagattctatgatagcagaaggatgtatattttagcttgtcatgacgtgtcatgataacgaaggacactgagaaagaggatagtccagagccccgttcttgtgaatgttttgtgtttgttttgacatgtgtgtttggtttgggtttttttgtttttgttgtttttgagctgcactgagcagggtgctgggcaggctggggcatgggcacctctgcaggagactggacaccgactaaggactgggggcctgagatcagctgtgaacatttgcagcacaatgcatgcaagtcagggatgtgggggtcccacagccagcagcaccccctgatggaacaactgtacatttgccaatgggttttccccacaagactacggtttttactacaaataaacttacgttctattctgca

//