2024-05-03 09:35:28, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_039104730 5269 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus vav guanine nucleotide exchange factor 2 (Vav2), transcript variant X1, mRNA. ACCESSION XM_039104730 VERSION XM_039104730.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_051338.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_015227675.2-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/06/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..5269 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /db_xref="taxon:10116" /chromosome="3" /sex="male" /tissue_type="kidney" /country="USA: Wisconsin, Milwaukee, Medical College of Wisconsin" /collection_date="2019-03-08" /collected_by="Rebecca Schilling" gene 1..5269 /gene="Vav2" /note="vav guanine nucleotide exchange factor 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 ESTs, 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 35 samples with support for all annotated introns" /db_xref="GeneID:296603" /db_xref="RGD:1306285" CDS 551..3187 /gene="Vav2" /codon_start=1 /product="guanine nucleotide exchange factor VAV2 isoform X1" /protein_id="XP_038960658.1" /db_xref="GeneID:296603" /db_xref="RGD:1306285" /translation="
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSIAQSKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEVQQPMIRYMQKMGLTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMGPLRQVLSPVDMATIFINLEDLIKVHHSFLRAIDVSMMAGGSTLAKVFLEFKERLLIYGEYCSHMEHAQSALNQLLASRDDFRQKVEECTLKVQEGKFKLQDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLKEALEAMQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHNKDIKKSHGKMWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYLCTRCGVGAHKECLEVIPPCKMSSPADADAPGAGLGPKMVAVQNYHGNPAPPGKPVLTFQTGDVIELLRGDPDSPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPVGRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKFPYKSRERAATRASSRSPASCASYSFSFLSPQGLSFAPQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ"
misc_feature 554..910 /gene="Vav2" /note="calponin homology (CH) domain found in VAV2 protein and similar proteins; Region: CH_VAV2; cd21263" /db_xref="CDD:409112" misc_feature order(557..559,569..571,758..760,764..769,776..781, 785..787,818..844,860..862,866..871,875..880,887..892, 899..901) /gene="Vav2" /note="putative actin binding site [polypeptide binding]; other site" /db_xref="CDD:409112" misc_feature 1145..1672 /gene="Vav2" /note="Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain. It appears that PH domains invariably occur C-terminal to RhoGEF/DH domains; Region: RhoGEF; cd00160" /db_xref="CDD:238091" misc_feature order(1163..1165,1175..1177,1442..1444,1526..1531, 1538..1543,1547..1552,1559..1564,1571..1576,1583..1585, 1658..1660,1670..1672) /gene="Vav2" /note="GTPase interaction site [polypeptide binding]; other site" /db_xref="CDD:238091" misc_feature 1715..2098 /gene="Vav2" /note="Vav pleckstrin homology (PH) domain; Region: PH_Vav; cd01223" /db_xref="CDD:269930" misc_feature 2105..2278 /gene="Vav2" /note="protein kinase C conserved region 1 (C1 domain) found in VAV2 protein; Region: C1_VAV2; cd20868" /db_xref="CDD:410418" misc_feature order(2120..2122,2159..2161,2168..2170,2210..2212, 2219..2221,2234..2236,2243..2245,2264..2266) /gene="Vav2" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:410418" misc_feature 2318..2497 /gene="Vav2" /note="First Src homology 3 domain of VAV2 protein; Region: SH3_VAV2_1; cd11980" /db_xref="CDD:212913" misc_feature order(2333..2335,2339..2341,2348..2350,2372..2374, 2429..2434,2477..2479,2483..2488) /gene="Vav2" /note="peptide ligand binding site [polypeptide binding]; other site" /db_xref="CDD:212913" misc_feature 2549..2857 /gene="Vav2" /note="Src homology 2 (SH2) domain found in the Vav2 proteins; Region: SH2_Vav2; cd10406" /db_xref="CDD:198269" misc_feature order(2588..2590,2642..2644,2705..2707,2711..2713) /gene="Vav2" /note="phosphotyrosine binding pocket [polypeptide binding]; other site" /db_xref="CDD:198269" misc_feature order(2708..2710,2789..2791) /gene="Vav2" /note="hydrophobic binding pocket [polypeptide binding]; other site" /db_xref="CDD:198269" misc_feature 3005..3178 /gene="Vav2" /note="C-terminal (or second) Src homology 3 domain of VAV2 protein; Region: SH3_VAV2_2; cd11977" /db_xref="CDD:212910" misc_feature order(3023..3025,3029..3031,3038..3040,3050..3052, 3110..3115,3152..3154,3158..3163) /gene="Vav2" /note="peptide ligand binding site [polypeptide binding]; other site" /db_xref="CDD:212910" ORIGIN
cctggagccgcggagcctcggagtcccagtgccccgcgagtagcgtagagcccgcgggcccggcgaacaaagcgacggtggggcgagtagctcaggcgccggacgcagggaccgagcgacccgctgcgcctttgtctcgggtggggcaggagcggcggccggagcggggcgccccgaacgcagaatgcggcgcccagaggggcggatcgaagagcgctgcggcggcaggaggtgtggagcccgggccggagcccgagcgcacttgtgtgtgtgaaggggggacccggcacactgccccgagagcgcctagtggccgcacgtgggcgggagccgcggcccgctagtagcccgaggaggaggaggaggaagaggagggccgtgtggccgcgcagcggggacccggggccgcctgcgcgaagccccgccccggcggccgagccccgcgcgggcggtcgggatgctccgcggtcaccgcactttggccggagcgctgccctgagccagctggcccagcggccgcggcggcgagcgcacgggcgccgcgggcgccatggagcagtggcggcaatgcggccgctggctcattgactgcaaggtcctgccgcccaaccaccgcgtcgtgtggccctcggcggtggtcttcgacctggcgcaggcgctgcgcgacggcgtccttctgtgccagctgctgcacaacctctcccccggctccatcgaccttaaggacatcaacttccggccgcagatgtcccagttcctgtgtctgaagaatattcgcaccttcctcaaagtctgccacgacaaatttggactaaggaacagtgagctgtttgaccctttcgacctctttgatgtccgagacttcgggaaggtcatctctgccgtgtcccgtctgtccctgcacagcatcgcgcagagcaaagggatcaggccttttccatcagaggagacggctgaaaacgatgacgatgtctaccggagtctggaagagctggctgacgagcatgacctgggtgaggacatctacgactgtgtcccgtgtgaagatgaaggagatgacatttatgaggacatcatcaaggtggaggtgcagcagcccatgatcagatacatgcagaaaatgggactaaccgaggacgacaagaggagctgctgcttgttagagattcaggagaccgaggccaagtactaccgcaccctggaggacattgagaagaactacatgggtcccttgcggcaggtgctgagccccgtggacatggccaccatcttcatcaacctggaggacctcatcaaggtgcaccacagctttctgcgagccatcgatgtgtccatgatggctggtggcagtaccctggctaaggtcttcctggagtttaaggaacggctcctgatctacggagagtactgtagccacatggagcatgcgcagagcgcactgaaccagctcctcgccagccgagacgacttcaggcagaaagtggaggagtgcacactcaaggtccaggagggcaagttcaagctgcaggatctgctggtggtgcccatgcagcgggtgctcaagtaccacctgttgctcaaggagctcctgagccattccgcagaccggcctgaaagacaacagctcaaagaagcactggaagccatgcaggacttggccatgtatattaatgaagtgaaacgggacaaggagaccttgaagaagattagtgagttccagtgctccatagaaaacctgcaagtgaagctggaggaatttgggaggccgaagattgacggggagctgaaagttcggtccatagtcaaccacaccaagcaagacaggtacctgttcctgtttgacaaggtggtcatcgtgtgtaagaggaagggctacagctatgagctgaaggaggttattgaactgctcttccacaagatgactgatgaccccatgcacaacaaagacatcaagaagtctcatgggaagatgtggtcctatggcttctacctgattcacctccaagggaagcaaggctttcagttcttctgcaagacggaagacatgaaacggaagtggatggagcagttcgagatggccatgtcaaacatcaagccagacaaggccaatgccaaccatcatagtttccagatgtacacgtttgacaagaccaccaactgcaaagcctgcaagatgttcctcaggggtaccttctaccagggatacctgtgtaccagatgtggtgtcggggcacacaaggagtgcctggaggtgatacccccctgcaagatgagttcgcctgcagatgcggacgctcccggagcaggactaggtcccaagatggttgccgtgcagaattaccatggtaacccagcccctcccgggaagcccgtgttgaccttccagacaggggatgtgatagagctgctccggggtgaccccgattctccttggtgggaggggaggctggttcaaactcggaagtcagggtatttccccagctcatctgtgaagccctgcccggtggacggaaggccgcctgttggccgcccgccatcccgggagatcgattacactgcatacccgtggttcgctggcaacatggaacggcagcagacggacaatctactcaagtctcatgccagcgggacctacctcatcagagagcgcccagcagaggcagagcgtttcgccatcagcatcaagttcaatgatgaagtgaaacacatcaaggtggtggaaaaagacagctggatccacatcacggaagctaagaagtttgagagcctcctggagctggtggagtactaccagtgccactcacttaaggagagcttcaagcagttagacactacactcaagttcccctacaagtctcgggagcgcgccgccaccagggcctcaagccgatctccagcttcgtgtgcttcctacagcttttcttttctcagtcctcagggcctcagctttgccccccagggcccctctgctcccttctggtcagtgttcacaccgcgggtcatcggcacagccgtggccaggtacaactttgctgcacgagacatgcgggagctgtcgctgcgggaaggtgatgtggtgaagatctacagccggatcggtggggaccagggctggtggaagggcgagacgaacgggcggatcggttggtttccttcgacgtacgtggaagaggaaggcatccagtgagggcgagacctggacagaacccacagatgctcttgggagtctccccagctctgaagtccgcctctggcttctccgtagctctgggaactgcctgctaagcctgcagctgttatggcccctagggatggggagggtgtcccaccatcacctgccctaggtggcctgtgcctgggtacattccttgtacatagaggagatccgtgctggccacacccagagcaccaaggatggggagctcaggccatatggccaagcatgtgtggatgacagcaaaggtcagaagctactgcctgcccctctggtttagatggttgctcaggagcccagacttcgactcatggtgtgccagggagggctggggacaacagggggtcccttcccaggcccatctgctgccccacactgatctgcctgtcttttctgctgctctctagagtgtgtgtcaggttttgggaggcaggcaggaccagagccaagctgtgctgtagcacactccaggcccagctgggagagagcttgcacaggggccgctggatcacgctagctctggagatttccctggctgcctcccttcctgacacagcagggtcctgctgcgtgctaactgggcaggcccctccctcatgagggaccttcggaccgatgacattgctgacccatccccagcccacccagtcagtggtactgctctttgcttgttgaagcccctttcctgagccaggaaacaggtcttttctgccctgctgccaggggggacacatctgtgaacctcgaagagcagggtagaaaaccaggttcccctccctgctcgctgtctcttttctctccgggaggcactcttgggtcttctgcactctaaaccatgctcactaggagtctgctggcctttgcactagatgttagtttgagcccttgtctggtatcccacaaggattcctgcaacccacacactgggcttatggccagctcaaaataagtgctcttgggggtctctgccctttcacttcttctcctggtgcttcctggcctttgacctctgcttgcttggccaaccctcttttcacccggtggagttctgagtggaagcttatgtgaagacacacacacagactcttgggccctttctcccctcatccagctgcccattcctggatgagtaggagccaaggttagggacactgtcccactgtcccactgtccccaacggagtggataatgcactacttgctcctggggacactttccagagttggcttatgtcctccagcttggtgtccacatataacatgctaggatgttaggggaggcagagagggattcggagaaggggagcagcaggaagagagagaccttggaaagcctcagctatgagaaactgggagtgaagggtttggagagggccggggcgcgggccacctacactgctccttggcccagcctgcccagtgcaagtgcagaccttggggagggctctgtcggcaggagccatacgaacgccctcacgtcagtcacgacaccctgtgctttaggttttgtttcgtttgtttgtttttctgttgtagctttttttccttttttgtcctgttacattttgttttgcctgttcgtatcttagaaggggggaaagttgtaattatttcatctaaatctcccattatatatctgtgaataagagattctatgatagcagaaggatgtatattttagcttgtcatgacgtgtcatgataacgaaggacactgagaaagaggatagtccagagccccgttcttgtgaatgttttgtgtttgttttgacatgtgtgtttggtttgggtttttttgtttttgttgtttttgagctgcactgagcagggtgctgggcaggctggggcatgggcacctctgcaggagactggacaccgactaaggactgggggcctgagatcagctgtgaacatttgcagcacaatgcatgcaagtcagggatgtgggggtcccacagccagcagcaccccctgatggaacaactgtacatttgccaatgggttttccccacaagactacggtttttactacaaataaacttacgttctattctgca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]