2024-05-05 03:53:06, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_039097945 2320 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus carboxylesterase-like 1 (Cesl1), transcript variant X4, mRNA. ACCESSION XM_039097945 VERSION XM_039097945.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_051354.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_015227675.2-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/06/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2320 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /db_xref="taxon:10116" /chromosome="19" /sex="male" /tissue_type="kidney" /country="USA: Wisconsin, Milwaukee, Medical College of Wisconsin" /collection_date="2019-03-08" /collected_by="Rebecca Schilling" gene 1..2320 /gene="Cesl1" /note="carboxylesterase-like 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 3 ESTs, 38 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:501232" /db_xref="RGD:1565666" CDS 471..2132 /gene="Cesl1" /codon_start=1 /product="liver carboxylesterase B-1 isoform X2" /protein_id="XP_038953873.1" /db_xref="GeneID:501232" /db_xref="RGD:1565666" /translation="
MSCCGLQKKGNPSSPPVVDTMKGKVLGKYASLEGVTQSVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTTYPPMCSQDATKGQRMNDLLTNRKEKVHLQFSEDCLYLNIYTPADFTKDSRMPVMVWIHGGGLTQGGASTYDGQVLSAYENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIANFGGDPGSVTIFGESAGGFSVSVLVLSPLSKNLYHRAISESGVVLITELFTKDVRPAAKQIADMAGCKTTTSAIIVHCLRQKTEEELLEIMEKMNLIKLSSQRDTKESYHFLSTVIDDVVLPKDPKEILAEKNFNTVPYIVGINKQECGWLLPTMMRFVPPDVKLDKKMAIMLLEKFASIYGIPEDIIPVAIEKYRKGSDDPIKIRDGILAFIGDALFCIPSVMVSRDHRDAGAPTYVYEYQYYPSFSSPQRPKDVVGDHADDVYSVFGAPILRDGASEEEIKLSKMVMKFWANFARNGNPNGRGLPHWPQYDQKEEYLQIGATTQQSQGLKAEEVAFWTQLLAKRQPQPHHNEL"
misc_feature 510..2081 /gene="Cesl1" /note="Carboxylesterase family; Region: COesterase; pfam00135" /db_xref="CDD:395084" misc_feature order(867..875,1104..1112,1119..1121,1590..1592, 1602..1604,1701..1703,1845..1847,1854..1856) /gene="Cesl1" /note="substrate binding pocket [chemical binding]; other site" /db_xref="CDD:238191" misc_feature order(1107..1109,1503..1505,1842..1844) /gene="Cesl1" /note="catalytic triad [active]" /db_xref="CDD:238191" ORIGIN
agtttgagaactcctggcattctgaagagagagtgttacaggggaaaatgtttatgtgagaagctgatgactgtttatggccatctgtaatctgagatttccatattaattgtttagatataagagagcaagtgatgggtagatggggtagatgggtgtttagataaagcagggtaaacttggaagagctctggctaagggagaggacaagtttttggtgtagttctgcattgtgtaattgggttctgtgggcaggacagacgggttcccagaaagtgggcaggaccttacattccccttccttgtagaccagagtcagagactctattgactggagtatctgcccacgcaagatgtgcctcaggtccctgttcctggtgtccctagcaacctgtgtggtttgtgcctcactgcatggagcttacagaaatcgacaatgttaaatatttagtttcacaaactctgtaaaaatgagctgctgtggcctacaaaaaaaaggaaacccctcttcaccacctgtggtggacaccatgaaaggcaaggtcctggggaagtatgccagtttagaaggagtcacacagtctgtagccgtcttcctgggagtcccttttgccaagccccctcttggatctctgaggtttgctccaccacagcctgcagagccctggagcttcgtgaagaacaccaccacctatccacctatgtgctcccaagatgcaacaaaagggcagaggatgaatgatctcctaaccaacagaaaggagaaagtccatctccagttttctgaagattgtctctacctgaatatttacactcctgcagactttacaaaggatagcaggatgccagtgatggtgtggatccatggaggtggactaacacagggcggggcatcaacctatgatggccaggtcctctctgcctatgaaaacgtggtggtagtggccattcaatatcgcctgggcatctggggattcttcagcacaggggatgaacacagcaggggaaactggggtcatttggaccaagtagctgcgctgcactgggtccaggacaacattgccaactttgggggtgacccaggctctgtgaccatctttggagagtcagcaggaggtttcagtgtctctgttcttgtgttgtccccactgtccaagaacctctaccacagggccatttctgagagtggggtggtcctcattactgaattgtttactaaggatgttaggccagccgctaagcaaattgctgatatggctggatgtaaaaccaccacctctgccatcattgttcactgcctgcgtcaaaagacagaagaggagctcttagagatcatggaaaaaatgaatctgattaaactcagttcacaaagggataccaaagagagctaccactttttgtcaactgtgattgacgatgtggtgctgccaaaggacccaaaagagatcctggctgagaagaacttcaacaccgtgccctacattgtgggaatcaacaagcaagagtgtggctggcttctgccaacgatgatgagatttgtaccacctgatgtaaaattggacaagaagatggccattatgctcctggagaaatttgcttccatatatggtataccagaggatattattccagttgctattgagaagtacagaaaaggtagtgatgaccccatcaagatcagagatggaatccttgcctttattggggatgcgttattttgtatcccatcagtgatggtgtcccgtgaccacagagatgctggagctcccacctacgtgtatgagtatcaatactacccaagcttctcatcaccccaaagacccaaggatgtagtaggagaccatgcagatgatgtctactctgtctttggtgccccaattttaagagatggtgcctcagaagaggagatcaagctcagcaagatggtgatgaaattttgggccaactttgctcggaatgggaaccctaatggccgagggctacctcattggccacagtatgaccagaaagaagaatatctgcagattggtgccaccacccagcaatcgcagggactgaaagcagaggaagtggctttttggacacagttactggctaagagacaacctcagccccaccacaatgagctgtgaatgcaagtctctgtcagcttcagaacaagcaagccaagatattgttcttccagtaaagatgtttgtaaatgaaagatggatctggaggatcctgaagaattttgtaatagagacagggagaacccaggaaagagaaatatttgtacttggcatcaatttagagaataaatgacatttttacagttaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]