GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 21:49:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_039097945            2320 bp    mRNA    linear   ROD 11-JUN-2023
DEFINITION  PREDICTED: Rattus norvegicus carboxylesterase-like 1 (Cesl1),
            transcript variant X4, mRNA.
ACCESSION   XM_039097945
VERSION     XM_039097945.1
DBLINK      BioProject: PRJNA677964
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051354.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_015227675.2-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/06/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2320
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /db_xref="taxon:10116"
                     /chromosome="19"
                     /sex="male"
                     /tissue_type="kidney"
                     /country="USA: Wisconsin, Milwaukee, Medical College of
                     Wisconsin"
                     /collection_date="2019-03-08"
                     /collected_by="Rebecca Schilling"
     gene            1..2320
                     /gene="Cesl1"
                     /note="carboxylesterase-like 1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     mRNA, 3 ESTs, 38 Proteins, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     7 samples with support for all annotated introns"
                     /db_xref="GeneID:501232"
                     /db_xref="RGD:1565666"
     CDS             471..2132
                     /gene="Cesl1"
                     /codon_start=1
                     /product="liver carboxylesterase B-1 isoform X2"
                     /protein_id="XP_038953873.1"
                     /db_xref="GeneID:501232"
                     /db_xref="RGD:1565666"
                     /translation="
MSCCGLQKKGNPSSPPVVDTMKGKVLGKYASLEGVTQSVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTTYPPMCSQDATKGQRMNDLLTNRKEKVHLQFSEDCLYLNIYTPADFTKDSRMPVMVWIHGGGLTQGGASTYDGQVLSAYENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIANFGGDPGSVTIFGESAGGFSVSVLVLSPLSKNLYHRAISESGVVLITELFTKDVRPAAKQIADMAGCKTTTSAIIVHCLRQKTEEELLEIMEKMNLIKLSSQRDTKESYHFLSTVIDDVVLPKDPKEILAEKNFNTVPYIVGINKQECGWLLPTMMRFVPPDVKLDKKMAIMLLEKFASIYGIPEDIIPVAIEKYRKGSDDPIKIRDGILAFIGDALFCIPSVMVSRDHRDAGAPTYVYEYQYYPSFSSPQRPKDVVGDHADDVYSVFGAPILRDGASEEEIKLSKMVMKFWANFARNGNPNGRGLPHWPQYDQKEEYLQIGATTQQSQGLKAEEVAFWTQLLAKRQPQPHHNEL"
     misc_feature    510..2081
                     /gene="Cesl1"
                     /note="Carboxylesterase family; Region: COesterase;
                     pfam00135"
                     /db_xref="CDD:395084"
     misc_feature    order(867..875,1104..1112,1119..1121,1590..1592,
                     1602..1604,1701..1703,1845..1847,1854..1856)
                     /gene="Cesl1"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238191"
     misc_feature    order(1107..1109,1503..1505,1842..1844)
                     /gene="Cesl1"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238191"
ORIGIN      
agtttgagaactcctggcattctgaagagagagtgttacaggggaaaatgtttatgtgagaagctgatgactgtttatggccatctgtaatctgagatttccatattaattgtttagatataagagagcaagtgatgggtagatggggtagatgggtgtttagataaagcagggtaaacttggaagagctctggctaagggagaggacaagtttttggtgtagttctgcattgtgtaattgggttctgtgggcaggacagacgggttcccagaaagtgggcaggaccttacattccccttccttgtagaccagagtcagagactctattgactggagtatctgcccacgcaagatgtgcctcaggtccctgttcctggtgtccctagcaacctgtgtggtttgtgcctcactgcatggagcttacagaaatcgacaatgttaaatatttagtttcacaaactctgtaaaaatgagctgctgtggcctacaaaaaaaaggaaacccctcttcaccacctgtggtggacaccatgaaaggcaaggtcctggggaagtatgccagtttagaaggagtcacacagtctgtagccgtcttcctgggagtcccttttgccaagccccctcttggatctctgaggtttgctccaccacagcctgcagagccctggagcttcgtgaagaacaccaccacctatccacctatgtgctcccaagatgcaacaaaagggcagaggatgaatgatctcctaaccaacagaaaggagaaagtccatctccagttttctgaagattgtctctacctgaatatttacactcctgcagactttacaaaggatagcaggatgccagtgatggtgtggatccatggaggtggactaacacagggcggggcatcaacctatgatggccaggtcctctctgcctatgaaaacgtggtggtagtggccattcaatatcgcctgggcatctggggattcttcagcacaggggatgaacacagcaggggaaactggggtcatttggaccaagtagctgcgctgcactgggtccaggacaacattgccaactttgggggtgacccaggctctgtgaccatctttggagagtcagcaggaggtttcagtgtctctgttcttgtgttgtccccactgtccaagaacctctaccacagggccatttctgagagtggggtggtcctcattactgaattgtttactaaggatgttaggccagccgctaagcaaattgctgatatggctggatgtaaaaccaccacctctgccatcattgttcactgcctgcgtcaaaagacagaagaggagctcttagagatcatggaaaaaatgaatctgattaaactcagttcacaaagggataccaaagagagctaccactttttgtcaactgtgattgacgatgtggtgctgccaaaggacccaaaagagatcctggctgagaagaacttcaacaccgtgccctacattgtgggaatcaacaagcaagagtgtggctggcttctgccaacgatgatgagatttgtaccacctgatgtaaaattggacaagaagatggccattatgctcctggagaaatttgcttccatatatggtataccagaggatattattccagttgctattgagaagtacagaaaaggtagtgatgaccccatcaagatcagagatggaatccttgcctttattggggatgcgttattttgtatcccatcagtgatggtgtcccgtgaccacagagatgctggagctcccacctacgtgtatgagtatcaatactacccaagcttctcatcaccccaaagacccaaggatgtagtaggagaccatgcagatgatgtctactctgtctttggtgccccaattttaagagatggtgcctcagaagaggagatcaagctcagcaagatggtgatgaaattttgggccaactttgctcggaatgggaaccctaatggccgagggctacctcattggccacagtatgaccagaaagaagaatatctgcagattggtgccaccacccagcaatcgcagggactgaaagcagaggaagtggctttttggacacagttactggctaagagacaacctcagccccaccacaatgagctgtgaatgcaagtctctgtcagcttcagaacaagcaagccaagatattgttcttccagtaaagatgtttgtaaatgaaagatggatctggaggatcctgaagaattttgtaatagagacagggagaacccaggaaagagaaatatttgtacttggcatcaatttagagaataaatgacatttttacagttaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]