GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 09:45:31, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_039084306            1169 bp    mRNA    linear   ROD 11-JUN-2023
DEFINITION  PREDICTED: Rattus norvegicus secreted phosphoprotein 2 (Spp2),
            transcript variant X1, mRNA.
ACCESSION   XM_039084306
VERSION     XM_039084306.1
DBLINK      BioProject: PRJNA677964
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051344.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_015227675.2-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/06/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1169
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /db_xref="taxon:10116"
                     /chromosome="9"
                     /sex="male"
                     /tissue_type="kidney"
                     /country="USA: Wisconsin, Milwaukee, Medical College of
                     Wisconsin"
                     /collection_date="2019-03-08"
                     /collected_by="Rebecca Schilling"
     gene            1..1169
                     /gene="Spp2"
                     /note="secreted phosphoprotein 2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     mRNA, 12 ESTs, and 100% coverage of the annotated genomic
                     feature by RNAseq alignments, including 17 samples with
                     support for all annotated introns"
                     /db_xref="GeneID:94168"
                     /db_xref="RGD:708488"
     CDS             468..1052
                     /gene="Spp2"
                     /codon_start=1
                     /product="secreted phosphoprotein 24 isoform X1"
                     /protein_id="XP_038940234.1"
                     /db_xref="GeneID:94168"
                     /db_xref="RGD:708488"
                     /translation="
MELATMKTLVMLVLGMHYWCASGFPVYDYDPSSLQEALSASVAKVNSQSLSPYLFRATRSSLKRVNVLDEDTLVMNLEFTVQETTCLRESGDPSTCAFQRGYSVPTAACRSTVQMSKGQVKDVWAHCRWASTSESNSSEEMIFGDMARSHRRRNDYLLGFLYDEPKEITRRGHPPAHRRFLNLQRRARVNSGFE"
     misc_feature    561..767
                     /gene="Spp2"
                     /note="Cystatin-like domain; Cystatins are a family of
                     cysteine protease inhibitors that occur mainly as single
                     domain proteins. However some extracellular proteins such
                     as kininogen, His-rich glycoprotein and fetuin also
                     contain these domains; Region: CY; cl09238"
                     /db_xref="CDD:447698"
     misc_feature    666..854
                     /gene="Spp2"
                     /note="Secreted phosphoprotein 24 (Spp-24) cystatin-like
                     domain; Region: Spp-24; pfam07448"
                     /db_xref="CDD:429466"
ORIGIN      
gtggccggcagagctaagcagacaggcaaaatggccctgcatgtgtgaagtctctaggaagggagaaagctggctctgagagatggagggggcagggttttgaggaccgggttaaggaatagtcaccattttgttgagtccacaattatgtcccctcccccaaagaatgaaatgcaaagagagaaggtcaacatgatacagggagacccaagcctctctgaatgtctcctgctgtgggctaaagtccctcagagaggtccaaacttcaaaagtagcctcagcctggaatttttccacaggaaaagtcagcagtaaatattgacacgggaatcaatcatctctactgaggttccagactgcttcagccagccagggcagctaggtcgcaggtgacaaggataagacagtcaccctcggaaagagctgtagagaggccatctccttggctctgggtcgccgtcctcgggatggagctggcaacgatgaagacgctggttatgttggtgctgggaatgcactactggtgtgcctcaggtttcccggtgtacgactacgacccttcctctctgcaagaagctctcagtgcctcagtggctaaggtgaactcgcaatccctgagtccttacctgtttcgggcgacgcggagctccctgaagagagttaatgtcctggatgaagacacactggtcatgaacttagagttcaccgttcaggaaactacatgcctaagagagtctggtgatccctccacctgcgccttccaaaggggctactctgtgccaacagctgcttgcaggagcacagtgcagatgtccaagggacaggtgaaggatgtgtgggctcactgccgctgggcgtccacatccgagtccaacagcagtgaggagatgatttttggggacatggcaagatcccaccgacgaagaaatgattatctacttggctttctttatgatgaacccaaagagatcacgaggaggggacatcctcctgcccatagaaggttcctgaacctccaacgcagagcaagagtcaattctggctttgagtgacatcctggagattccatgaaagaaagagaagcagaagctgaaatgaaggacatggagaattgtgtctttttcctttgataagctccactttgcaataaagatcttccccttcctgta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]