2024-05-20 09:04:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_039084306 1169 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus secreted phosphoprotein 2 (Spp2), transcript variant X1, mRNA. ACCESSION XM_039084306 VERSION XM_039084306.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_051344.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_015227675.2-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/06/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1169 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /db_xref="taxon:10116" /chromosome="9" /sex="male" /tissue_type="kidney" /country="USA: Wisconsin, Milwaukee, Medical College of Wisconsin" /collection_date="2019-03-08" /collected_by="Rebecca Schilling" gene 1..1169 /gene="Spp2" /note="secreted phosphoprotein 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 12 ESTs, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:94168" /db_xref="RGD:708488" CDS 468..1052 /gene="Spp2" /codon_start=1 /product="secreted phosphoprotein 24 isoform X1" /protein_id="XP_038940234.1" /db_xref="GeneID:94168" /db_xref="RGD:708488" /translation="
MELATMKTLVMLVLGMHYWCASGFPVYDYDPSSLQEALSASVAKVNSQSLSPYLFRATRSSLKRVNVLDEDTLVMNLEFTVQETTCLRESGDPSTCAFQRGYSVPTAACRSTVQMSKGQVKDVWAHCRWASTSESNSSEEMIFGDMARSHRRRNDYLLGFLYDEPKEITRRGHPPAHRRFLNLQRRARVNSGFE"
misc_feature 561..767 /gene="Spp2" /note="Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains; Region: CY; cl09238" /db_xref="CDD:447698" misc_feature 666..854 /gene="Spp2" /note="Secreted phosphoprotein 24 (Spp-24) cystatin-like domain; Region: Spp-24; pfam07448" /db_xref="CDD:429466" ORIGIN
gtggccggcagagctaagcagacaggcaaaatggccctgcatgtgtgaagtctctaggaagggagaaagctggctctgagagatggagggggcagggttttgaggaccgggttaaggaatagtcaccattttgttgagtccacaattatgtcccctcccccaaagaatgaaatgcaaagagagaaggtcaacatgatacagggagacccaagcctctctgaatgtctcctgctgtgggctaaagtccctcagagaggtccaaacttcaaaagtagcctcagcctggaatttttccacaggaaaagtcagcagtaaatattgacacgggaatcaatcatctctactgaggttccagactgcttcagccagccagggcagctaggtcgcaggtgacaaggataagacagtcaccctcggaaagagctgtagagaggccatctccttggctctgggtcgccgtcctcgggatggagctggcaacgatgaagacgctggttatgttggtgctgggaatgcactactggtgtgcctcaggtttcccggtgtacgactacgacccttcctctctgcaagaagctctcagtgcctcagtggctaaggtgaactcgcaatccctgagtccttacctgtttcgggcgacgcggagctccctgaagagagttaatgtcctggatgaagacacactggtcatgaacttagagttcaccgttcaggaaactacatgcctaagagagtctggtgatccctccacctgcgccttccaaaggggctactctgtgccaacagctgcttgcaggagcacagtgcagatgtccaagggacaggtgaaggatgtgtgggctcactgccgctgggcgtccacatccgagtccaacagcagtgaggagatgatttttggggacatggcaagatcccaccgacgaagaaatgattatctacttggctttctttatgatgaacccaaagagatcacgaggaggggacatcctcctgcccatagaaggttcctgaacctccaacgcagagcaagagtcaattctggctttgagtgacatcctggagattccatgaaagaaagagaagcagaagctgaaatgaaggacatggagaattgtgtctttttcctttgataagctccactttgcaataaagatcttccccttcctgta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]