2024-04-28 18:00:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_039084048 816 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus glutathione S-transferase alpha 3 (Gsta3), transcript variant X2, mRNA. ACCESSION XM_039084048 VERSION XM_039084048.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_051344.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_015227675.2-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/06/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..816 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /db_xref="taxon:10116" /chromosome="9" /sex="male" /tissue_type="kidney" /country="USA: Wisconsin, Milwaukee, Medical College of Wisconsin" /collection_date="2019-03-08" /collected_by="Rebecca Schilling" gene 1..816 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="glutathione S-transferase alpha 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 ESTs, 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 11 samples with support for all annotated introns" /db_xref="GeneID:494500" /db_xref="RGD:1591980" CDS 49..531 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /codon_start=1 /product="glutathione S-transferase alpha-5 isoform X2" /protein_id="XP_038939976.1" /db_xref="GeneID:494500" /db_xref="RGD:1591980" /translation="
MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSLMFEQVPMVEIDGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVADLELMVLYYPYMPPGEKEASLAKIKDKARNRYFPAYEKIPQLQLELGLVNLQVTLGGALD"
misc_feature 58..294 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold; Region: Thioredoxin_like; cl00388" /db_xref="CDD:444880" misc_feature 304..>465 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="C-terminal, alpha helical domain of the Glutathione S-transferase family; Region: GST_C_family; cl02776" /db_xref="CDD:445916" misc_feature order(325..330,337..342,349..351,451..453) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:198286" ORIGIN
tttcagagggaacaactgtttaacaagagaactcaagcaattgctgccatgccggggaagccagtccttcactacttcgatggcagggggagaatggagcccatccggtggctcctggctgcagctggagtagagtttgaagaaaattttctgaaaactcgggatgacctggccaggttaagaagtgatgggagtttgatgtttgaacaagtgcccatggtggagattgacgggatgaagctggtgcagaccaaagccattctcaactacattgccaccaaatacaacctctatgggaaggacatgaaggagagagccctcatcgacatgtatgcagaaggtgtggccgatctggagttgatggttctctattacccctacatgccccctggggagaaagaggcgagtcttgccaagatcaaggacaaagcaaggaaccgttacttccctgcctatgagaagattccacagttgcaattagaactcgggctcgtgaacctccaagtcacgctggggggtgcacttgattaaacagaatatcaccaccttttgactcaagagcgtcacggagaaagtaacacgtcagaaaatattctgcccctcatacgtggaggcccgggacagagggccatcagaagaccattggttcatttcaggatggatttgaagcatctacaataatggcagaggcgtggaaggaaagagacagggaggagatgtaaagggggaaaattgccaggattagcaacgttcctctcagaattagaacaaaaaaaagttacacaaaataaaagaataaagctctgtctttacaca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]