2024-05-05 22:20:29, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_039084047 1261 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus glutathione S-transferase alpha 3 (Gsta3), transcript variant X1, mRNA. ACCESSION XM_039084047 VERSION XM_039084047.1 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_051344.1) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_015227675.2-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/06/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1261 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /db_xref="taxon:10116" /chromosome="9" /sex="male" /tissue_type="kidney" /country="USA: Wisconsin, Milwaukee, Medical College of Wisconsin" /collection_date="2019-03-08" /collected_by="Rebecca Schilling" gene 1..1261 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="glutathione S-transferase alpha 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 5 ESTs, 72 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns" /db_xref="GeneID:494500" /db_xref="RGD:1591980" CDS 185..850 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /codon_start=1 /product="glutathione S-transferase alpha-5 isoform X1" /protein_id="XP_038939975.1" /db_xref="GeneID:494500" /db_xref="RGD:1591980" /translation="
MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSLMFEQVPMVEIDGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVADLELMVLYYPYMPPGEKEASLAKIKDKARNRYFPAYEKVLKSHGQDYLVGNKLSRADVSLVELLYHVEEMDPGIVDNFPLLKALRTRVSNLPTVKKFLQPGSQRKPFDDEKCVESAKKIFS"
misc_feature 194..430 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens; Region: GST_N_Alpha; cd03077" /db_xref="CDD:239375" misc_feature order(215..217,221..223,227..229,233..238,245..247, 254..259,278..280,290..292,389..391,398..403) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="C-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:239375" misc_feature order(317..319,344..349,383..388) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="GSH binding site (G-site) [chemical binding]; other site" /db_xref="CDD:239375" misc_feature order(338..343,365..367,380..385,389..394,401..406, 416..418) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:239375" misc_feature 440..844 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="C-terminal, alpha helical domain of Class Alpha Glutathione S-transferases; Region: GST_C_Alpha; cd03208" /db_xref="CDD:198317" misc_feature order(440..445,449..451,461..469,473..478,485..487, 575..577) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:198317" misc_feature order(473..475,494..496,503..505,512..517,575..580, 587..589,638..649,656..658,665..670,677..682,689..691, 761..766,770..787) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="N-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:198317" misc_feature order(485..487,503..505,515..517,575..577,806..808, 830..832,842..844) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="substrate binding pocket (H-site) [chemical binding]; other site" /db_xref="CDD:198317" ORIGIN
tggatatctttaaactctagagagaaaggaccatgttggaaaatcatccttcgctggtacatcatggtttcttcagatatgatggatggctgatgtgttcatacacacactagtctcccaggaacggaggcaatggtgaacatgcttgtgtgatgtctctgctagaactcaagcaattgctgccatgccggggaagccagtccttcactacttcgatggcagggggagaatggagcccatccggtggctcctggctgcagctggagtagagtttgaagaaaattttctgaaaactcgggatgacctggccaggttaagaagtgatgggagtttgatgtttgaacaagtgcccatggtggagattgacgggatgaagctggtgcagaccaaagccattctcaactacattgccaccaaatacaacctctatgggaaggacatgaaggagagagccctcatcgacatgtatgcagaaggtgtggccgatctggagttgatggttctctattacccctacatgccccctggggagaaagaggcgagtcttgccaagatcaaggacaaagcaaggaaccgttacttccctgcctatgagaaggtgttgaagagccacggacaagattatctcgttggcaacaagctgagcagggctgatgtttccctggttgaacttctctaccatgtggaagagatggacccaggcattgtggacaacttccctctgctaaaggccctgagaaccagagtcagcaacctccccacagtgaagaaatttcttcagcctggcagccagaggaagccttttgatgatgagaaatgtgtagaatcagcgaagaagatcttcagttaattcagtcagctatggatacactgtacccacaaagccagcctcagaaagctctgcaacaatgaagtattttgactaaatgttgaccgtacttattgggagggtaacatgttttctaaggcttctgtgttaattcatatagacatgactcatgaggaattgctgggatgccatctagttgagttaaaacctcaatctcgatcacttcctcggatattttcttaatgttcaataaaacaaaacaagcttcttagacgctggagtatccaaacattgtcatgaaatagctgtcatatccttgtcaaacagcgtcacgtagaaaccctcgtgtcaaactctcttacgcaaaagtaatctttccttatggagagtgtcctttctagtgaaatacacgcagacgtgtgtgcactcaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]