GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-28 20:38:01, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_039084047            1261 bp    mRNA    linear   ROD 11-JUN-2023
DEFINITION  PREDICTED: Rattus norvegicus glutathione S-transferase alpha 3
            (Gsta3), transcript variant X1, mRNA.
ACCESSION   XM_039084047
VERSION     XM_039084047.1
DBLINK      BioProject: PRJNA677964
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051344.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_015227675.2-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/06/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1261
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /db_xref="taxon:10116"
                     /chromosome="9"
                     /sex="male"
                     /tissue_type="kidney"
                     /country="USA: Wisconsin, Milwaukee, Medical College of
                     Wisconsin"
                     /collection_date="2019-03-08"
                     /collected_by="Rebecca Schilling"
     gene            1..1261
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="glutathione S-transferase alpha 3; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 mRNAs, 5 ESTs, 72 Proteins, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     8 samples with support for all annotated introns"
                     /db_xref="GeneID:494500"
                     /db_xref="RGD:1591980"
     CDS             185..850
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /codon_start=1
                     /product="glutathione S-transferase alpha-5 isoform X1"
                     /protein_id="XP_038939975.1"
                     /db_xref="GeneID:494500"
                     /db_xref="RGD:1591980"
                     /translation="
MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSLMFEQVPMVEIDGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVADLELMVLYYPYMPPGEKEASLAKIKDKARNRYFPAYEKVLKSHGQDYLVGNKLSRADVSLVELLYHVEEMDPGIVDNFPLLKALRTRVSNLPTVKKFLQPGSQRKPFDDEKCVESAKKIFS"
     misc_feature    194..430
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="GST_N family, Class Alpha subfamily; GSTs are
                     cytosolic dimeric proteins involved in cellular
                     detoxification by catalyzing the conjugation of
                     glutathione (GSH) with a wide range of endogenous and
                     xenobiotic alkylating agents, including carcinogens;
                     Region: GST_N_Alpha; cd03077"
                     /db_xref="CDD:239375"
     misc_feature    order(215..217,221..223,227..229,233..238,245..247,
                     254..259,278..280,290..292,389..391,398..403)
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239375"
     misc_feature    order(317..319,344..349,383..388)
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239375"
     misc_feature    order(338..343,365..367,380..385,389..394,401..406,
                     416..418)
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239375"
     misc_feature    440..844
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="C-terminal, alpha helical domain of Class Alpha
                     Glutathione S-transferases; Region: GST_C_Alpha; cd03208"
                     /db_xref="CDD:198317"
     misc_feature    order(440..445,449..451,461..469,473..478,485..487,
                     575..577)
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198317"
     misc_feature    order(473..475,494..496,503..505,512..517,575..580,
                     587..589,638..649,656..658,665..670,677..682,689..691,
                     761..766,770..787)
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198317"
     misc_feature    order(485..487,503..505,515..517,575..577,806..808,
                     830..832,842..844)
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198317"
ORIGIN      
tggatatctttaaactctagagagaaaggaccatgttggaaaatcatccttcgctggtacatcatggtttcttcagatatgatggatggctgatgtgttcatacacacactagtctcccaggaacggaggcaatggtgaacatgcttgtgtgatgtctctgctagaactcaagcaattgctgccatgccggggaagccagtccttcactacttcgatggcagggggagaatggagcccatccggtggctcctggctgcagctggagtagagtttgaagaaaattttctgaaaactcgggatgacctggccaggttaagaagtgatgggagtttgatgtttgaacaagtgcccatggtggagattgacgggatgaagctggtgcagaccaaagccattctcaactacattgccaccaaatacaacctctatgggaaggacatgaaggagagagccctcatcgacatgtatgcagaaggtgtggccgatctggagttgatggttctctattacccctacatgccccctggggagaaagaggcgagtcttgccaagatcaaggacaaagcaaggaaccgttacttccctgcctatgagaaggtgttgaagagccacggacaagattatctcgttggcaacaagctgagcagggctgatgtttccctggttgaacttctctaccatgtggaagagatggacccaggcattgtggacaacttccctctgctaaaggccctgagaaccagagtcagcaacctccccacagtgaagaaatttcttcagcctggcagccagaggaagccttttgatgatgagaaatgtgtagaatcagcgaagaagatcttcagttaattcagtcagctatggatacactgtacccacaaagccagcctcagaaagctctgcaacaatgaagtattttgactaaatgttgaccgtacttattgggagggtaacatgttttctaaggcttctgtgttaattcatatagacatgactcatgaggaattgctgggatgccatctagttgagttaaaacctcaatctcgatcacttcctcggatattttcttaatgttcaataaaacaaaacaagcttcttagacgctggagtatccaaacattgtcatgaaatagctgtcatatccttgtcaaacagcgtcacgtagaaaccctcgtgtcaaactctcttacgcaaaagtaatctttccttatggagagtgtcctttctagtgaaatacacgcagacgtgtgtgcactcaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]