2024-05-01 11:14:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_006233761 4602 bp mRNA linear ROD 11-JUN-2023 DEFINITION PREDICTED: Rattus norvegicus vav guanine nucleotide exchange factor 2 (Vav2), transcript variant X5, mRNA. ACCESSION XM_006233761 VERSION XM_006233761.3 DBLINK BioProject: PRJNA677964 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_051338.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Jan 21, 2021 this sequence version replaced XM_006233761.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_015227675.2-RS_2023_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/06/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..4602 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /db_xref="taxon:10116" /chromosome="3" /sex="male" /tissue_type="kidney" /country="USA: Wisconsin, Milwaukee, Medical College of Wisconsin" /collection_date="2019-03-08" /collected_by="Rebecca Schilling" gene 1..4602 /gene="Vav2" /note="vav guanine nucleotide exchange factor 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 ESTs, 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 202 samples with support for all annotated introns" /db_xref="GeneID:296603" /db_xref="RGD:1306285" CDS 1..2520 /gene="Vav2" /codon_start=1 /product="guanine nucleotide exchange factor VAV2 isoform X5" /protein_id="XP_006233823.1" /db_xref="GeneID:296603" /db_xref="RGD:1306285" /translation="
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSIAQSKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEVQQPMKMGLTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMGPLRQVLSPVDMATIFINLEDLIKVHHSFLRAIDVSMMAGGSTLAKVFLEFKERLLIYGEYCSHMEHAQSALNQLLASRDDFRQKVEECTLKVQEGKFKLQDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLKEALEAMQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHNKDIKKWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYLCTRCGVGAHKECLEVIPPCKMSSPADADAPGAGLGPKMVAVQNYHGNPAPPGKPVLTFQTGDVIELLRGDPDSPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPVGRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKFPYKSRERAATRASSRSPVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ"
misc_feature 4..360 /gene="Vav2" /note="calponin homology (CH) domain found in VAV2 protein and similar proteins; Region: CH_VAV2; cd21263" /db_xref="CDD:409112" misc_feature order(7..9,19..21,208..210,214..219,226..231,235..237, 268..294,310..312,316..321,325..330,337..342,349..351) /gene="Vav2" /note="putative actin binding site [polypeptide binding]; other site" /db_xref="CDD:409112" misc_feature 580..1107 /gene="Vav2" /note="Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain. It appears that PH domains invariably occur C-terminal to RhoGEF/DH domains; Region: RhoGEF; cd00160" /db_xref="CDD:238091" misc_feature order(598..600,610..612,877..879,961..966,973..978, 982..987,994..999,1006..1011,1018..1020,1093..1095, 1105..1107) /gene="Vav2" /note="GTPase interaction site [polypeptide binding]; other site" /db_xref="CDD:238091" misc_feature 1150..1518 /gene="Vav2" /note="Vav pleckstrin homology (PH) domain; Region: PH_Vav; cd01223" /db_xref="CDD:269930" misc_feature 1525..1698 /gene="Vav2" /note="protein kinase C conserved region 1 (C1 domain) found in VAV2 protein; Region: C1_VAV2; cd20868" /db_xref="CDD:410418" misc_feature 1738..1917 /gene="Vav2" /note="First Src homology 3 domain of VAV2 protein; Region: SH3_VAV2_1; cd11980" /db_xref="CDD:212913" misc_feature order(1753..1755,1759..1761,1768..1770,1792..1794, 1849..1854,1897..1899,1903..1908) /gene="Vav2" /note="peptide ligand binding site [polypeptide binding]; other site" /db_xref="CDD:212913" misc_feature 1969..2277 /gene="Vav2" /note="Src homology 2 (SH2) domain found in the Vav2 proteins; Region: SH2_Vav2; cd10406" /db_xref="CDD:198269" misc_feature order(2008..2010,2062..2064,2125..2127,2131..2133) /gene="Vav2" /note="phosphotyrosine binding pocket [polypeptide binding]; other site" /db_xref="CDD:198269" misc_feature order(2128..2130,2209..2211) /gene="Vav2" /note="hydrophobic binding pocket [polypeptide binding]; other site" /db_xref="CDD:198269" misc_feature 2338..2511 /gene="Vav2" /note="C-terminal (or second) Src homology 3 domain of VAV2 protein; Region: SH3_VAV2_2; cd11977" /db_xref="CDD:212910" misc_feature order(2356..2358,2362..2364,2371..2373,2383..2385, 2443..2448,2485..2487,2491..2496) /gene="Vav2" /note="peptide ligand binding site [polypeptide binding]; other site" /db_xref="CDD:212910" ORIGIN
atggagcagtggcggcaatgcggccgctggctcattgactgcaaggtcctgccgcccaaccaccgcgtcgtgtggccctcggcggtggtcttcgacctggcgcaggcgctgcgcgacggcgtccttctgtgccagctgctgcacaacctctcccccggctccatcgaccttaaggacatcaacttccggccgcagatgtcccagttcctgtgtctgaagaatattcgcaccttcctcaaagtctgccacgacaaatttggactaaggaacagtgagctgtttgaccctttcgacctctttgatgtccgagacttcgggaaggtcatctctgccgtgtcccgtctgtccctgcacagcatcgcgcagagcaaagggatcaggccttttccatcagaggagacggctgaaaacgatgacgatgtctaccggagtctggaagagctggctgacgagcatgacctgggtgaggacatctacgactgtgtcccgtgtgaagatgaaggagatgacatttatgaggacatcatcaaggtggaggtgcagcagcccatgaaaatgggactaaccgaggacgacaagaggagctgctgcttgttagagattcaggagaccgaggccaagtactaccgcaccctggaggacattgagaagaactacatgggtcccttgcggcaggtgctgagccccgtggacatggccaccatcttcatcaacctggaggacctcatcaaggtgcaccacagctttctgcgagccatcgatgtgtccatgatggctggtggcagtaccctggctaaggtcttcctggagtttaaggaacggctcctgatctacggagagtactgtagccacatggagcatgcgcagagcgcactgaaccagctcctcgccagccgagacgacttcaggcagaaagtggaggagtgcacactcaaggtccaggagggcaagttcaagctgcaggatctgctggtggtgcccatgcagcgggtgctcaagtaccacctgttgctcaaggagctcctgagccattccgcagaccggcctgaaagacaacagctcaaagaagcactggaagccatgcaggacttggccatgtatattaatgaagtgaaacgggacaaggagaccttgaagaagattagtgagttccagtgctccatagaaaacctgcaagtgaagctggaggaatttgggaggccgaagattgacggggagctgaaagttcggtccatagtcaaccacaccaagcaagacaggtacctgttcctgtttgacaaggtggtcatcgtgtgtaagaggaagggctacagctatgagctgaaggaggttattgaactgctcttccacaagatgactgatgaccccatgcacaacaaagacatcaagaagtggtcctatggcttctacctgattcacctccaagggaagcaaggctttcagttcttctgcaagacggaagacatgaaacggaagtggatggagcagttcgagatggccatgtcaaacatcaagccagacaaggccaatgccaaccatcatagtttccagatgtacacgtttgacaagaccaccaactgcaaagcctgcaagatgttcctcaggggtaccttctaccagggatacctgtgtaccagatgtggtgtcggggcacacaaggagtgcctggaggtgatacccccctgcaagatgagttcgcctgcagatgcggacgctcccggagcaggactaggtcccaagatggttgccgtgcagaattaccatggtaacccagcccctcccgggaagcccgtgttgaccttccagacaggggatgtgatagagctgctccggggtgaccccgattctccttggtgggaggggaggctggttcaaactcggaagtcagggtatttccccagctcatctgtgaagccctgcccggtggacggaaggccgcctgttggccgcccgccatcccgggagatcgattacactgcatacccgtggttcgctggcaacatggaacggcagcagacggacaatctactcaagtctcatgccagcgggacctacctcatcagagagcgcccagcagaggcagagcgtttcgccatcagcatcaagttcaatgatgaagtgaaacacatcaaggtggtggaaaaagacagctggatccacatcacggaagctaagaagtttgagagcctcctggagctggtggagtactaccagtgccactcacttaaggagagcttcaagcagttagacactacactcaagttcccctacaagtctcgggagcgcgccgccaccagggcctcaagccgatctccagtgttcacaccgcgggtcatcggcacagccgtggccaggtacaactttgctgcacgagacatgcgggagctgtcgctgcgggaaggtgatgtggtgaagatctacagccggatcggtggggaccagggctggtggaagggcgagacgaacgggcggatcggttggtttccttcgacgtacgtggaagaggaaggcatccagtgagggcgagacctggacagaacccacagatgctcttgggagtctccccagctctgaagtccgcctctggcttctccgtagctctgggaactgcctgctaagcctgcagctgttatggcccctagggatggggagggtgtcccaccatcacctgccctaggtggcctgtgcctgggtacattccttgtacatagaggagatccgtgctggccacacccagagcaccaaggatggggagctcaggccatatggccaagcatgtgtggatgacagcaaaggtcagaagctactgcctgcccctctggtttagatggttgctcaggagcccagacttcgactcatggtgtgccagggagggctggggacaacagggggtcccttcccaggcccatctgctgccccacactgatctgcctgtcttttctgctgctctctagagtgtgtgtcaggttttgggaggcaggcaggaccagagccaagctgtgctgtagcacactccaggcccagctgggagagagcttgcacaggggccgctggatcacgctagctctggagatttccctggctgcctcccttcctgacacagcagggtcctgctgcgtgctaactgggcaggcccctccctcatgagggaccttcggaccgatgacattgctgacccatccccagcccacccagtcagtggtactgctctttgcttgttgaagcccctttcctgagccaggaaacaggtcttttctgccctgctgccaggggggacacatctgtgaacctcgaagagcagggtagaaaaccaggttcccctccctgctcgctgtctcttttctctccgggaggcactcttgggtcttctgcactctaaaccatgctcactaggagtctgctggcctttgcactagatgttagtttgagcccttgtctggtatcccacaaggattcctgcaacccacacactgggcttatggccagctcaaaataagtgctcttgggggtctctgccctttcacttcttctcctggtgcttcctggcctttgacctctgcttgcttggccaaccctcttttcacccggtggagttctgagtggaagcttatgtgaagacacacacacagactcttgggccctttctcccctcatccagctgcccattcctggatgagtaggagccaaggttagggacactgtcccactgtcccactgtccccaacggagtggataatgcactacttgctcctggggacactttccagagttggcttatgtcctccagcttggtgtccacatataacatgctaggatgttaggggaggcagagagggattcggagaaggggagcagcaggaagagagagaccttggaaagcctcagctatgagaaactgggagtgaagggtttggagagggccggggcgcgggccacctacactgctccttggcccagcctgcccagtgcaagtgcagaccttggggagggctctgtcggcaggagccatacgaacgccctcacgtcagtcacgacaccctgtgctttaggttttgtttcgtttgtttgtttttctgttgtagctttttttccttttttgtcctgttacattttgttttgcctgttcgtatcttagaaggggggaaagttgtaattatttcatctaaatctcccattatatatctgtgaataagagattctatgatagcagaaggatgtatattttagcttgtcatgacgtgtcatgataacgaaggacactgagaaagaggatagtccagagccccgttcttgtgaatgttttgtgtttgttttgacatgtgtgtttggtttgggtttttttgtttttgttgtttttgagctgcactgagcagggtgctgggcaggctggggcatgggcacctctgcaggagactggacaccgactaaggactgggggcctgagatcagctgtgaacatttgcagcacaatgcatgcaagtcagggatgtgggggtcccacagccagcagcaccccctgatggaacaactgtacatttgccaatgggttttccccacaagactacggtttttactacaaataaacttacgttctattctgca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]