GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 08:55:05, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_173289                633 bp    mRNA    linear   ROD 19-MAR-2023
DEFINITION  Rattus norvegicus crystallin, gamma E (Cryge), mRNA.
ACCESSION   NM_173289 XM_001081859
VERSION     NM_173289.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 633)
  AUTHORS   Kim I, Saito T, Fujii N, Kanamoto T, Chatake T and Fujii N.
  TITLE     Site specific oxidation of amino acid residues in rat lens
            gamma-crystallin induced by low-dose gamma-irradiation
  JOURNAL   Biochem Biophys Res Commun 466 (4), 622-628 (2015)
   PUBMED   26385181
  REMARK    GeneRIF: Specific oxidation sites of methionine, cysteine and
            tryptophan in water-soluble and -insoluble gammaE and
            gammaF-crystallin were determined by one-shot analysis after
            low-dose gamma-irradiation.
REFERENCE   2  (bases 1 to 633)
  AUTHORS   Kwitek AE, Gullings-Handley J, Yu J, Carlos DC, Orlebeke K, Nie J,
            Eckert J, Lemke A, Andrae JW, Bromberg S, Pasko D, Chen D, Scheetz
            TE, Casavant TL, Soares MB, Sheffield VC, Tonellato PJ and Jacob
            HJ.
  TITLE     High-density rat radiation hybrid maps containing over 24,000
            SSLPs, genes, and ESTs provide a direct link to the rat genome
            sequence
  JOURNAL   Genome Res 14 (4), 750-757 (2004)
   PUBMED   15060019
REFERENCE   3  (bases 1 to 633)
  AUTHORS   Norledge BV, Hay RE, Bateman OA, Slingsby C and Driessen HP.
  TITLE     Towards a molecular understanding of phase separation in the lens:
            a comparison of the X-ray structures of two high Tc
            gamma-crystallins, gammaE and gammaF, with two low Tc
            gamma-crystallins, gammaB and gammaD
  JOURNAL   Exp Eye Res 65 (5), 609-630 (1997)
   PUBMED   9367641
REFERENCE   4  (bases 1 to 633)
  AUTHORS   Voorter CE, De Haard-Hoekman WA, Hermans MM, Bloemendal H and De
            Jong WW.
  TITLE     Differential synthesis of crystallins in the developing rat eye
            lens
  JOURNAL   Exp Eye Res 50 (4), 429-437 (1990)
   PUBMED   2338125
REFERENCE   5  (bases 1 to 633)
  AUTHORS   den Dunnen JT, van Neck JW, Cremers FP, Lubsen NH and Schoenmakers
            JG.
  TITLE     Nucleotide sequence of the rat gamma-crystallin gene region and
            comparison with an orthologous human region
  JOURNAL   Gene 78 (2), 201-213 (1989)
   PUBMED   2777080
REFERENCE   6  (bases 1 to 633)
  AUTHORS   den Dunnen,J.T. and Schoenmakers,J.G.
  TITLE     Consensus sequences of the Rattus norvegicus B1- and B2 repeats
  JOURNAL   Nucleic Acids Res 15 (6), 2772 (1987)
   PUBMED   3562235
REFERENCE   7  (bases 1 to 633)
  AUTHORS   Moormann,R.J., den Dunnen,J.T., Mulleners,L., Andreoli,P.,
            Bloemendal,H. and Schoenmakers,J.G.
  TITLE     Strict co-linearity of genetic and protein folding domains in an
            intragenically duplicated rat lens gamma-crystallin gene
  JOURNAL   J Mol Biol 171 (4), 353-368 (1983)
   PUBMED   6319707
REFERENCE   8  (bases 1 to 633)
  AUTHORS   Moormann,R.J., den Dunnen,J.T., Bloemendal,H. and Schoenmakers,J.G.
  TITLE     Extensive intragenic sequence homology in two distinct rat lens
            gamma-crystallin cDNAs suggests duplications of a primordial gene
  JOURNAL   Proc Natl Acad Sci U S A 79 (22), 6876-6880 (1982)
   PUBMED   6294661
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from M19359.1.
            
            On Jun 25, 2006 this sequence version replaced XM_001081859.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN06680452,
                              SAMN06680453 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..633
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="9"
                     /map="9q32"
     gene            1..633
                     /gene="Cryge"
                     /gene_synonym="Cryg5; Len"
                     /note="crystallin, gamma E"
                     /db_xref="GeneID:24279"
                     /db_xref="RGD:2423"
     exon            1..51
                     /gene="Cryge"
                     /gene_synonym="Cryg5; Len"
                     /inference="alignment:Splign:2.1.0"
     CDS             43..567
                     /gene="Cryge"
                     /gene_synonym="Cryg5; Len"
                     /note="gamma-2; gamma-E-crystallin; gamma-crystallin 3-1;
                     Crystallin, gamma polypeptide 5; gamma-crystallin D-like"
                     /codon_start=1
                     /product="gamma-crystallin E"
                     /protein_id="NP_775411.1"
                     /db_xref="GeneID:24279"
                     /db_xref="RGD:2423"
                     /translation="
MGKITFYEDRGFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWMLYEQPNFTGCQYFLRRGDYPDYQQWMGFSDSVRSCRLIPHSSSHRIRIYEREDYRGQMVEITDDCPHLQDRFHFSDFHSFHVMEGYWVLYEMPNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRRIMDFY"
     misc_feature    49..288
                     /gene="Cryge"
                     /gene_synonym="Cryg5; Len"
                     /note="Beta/gamma crystallins; Region: XTALbg; smart00247"
                     /db_xref="CDD:214583"
     misc_feature    292..303
                     /gene="Cryge"
                     /gene_synonym="Cryg5; Len"
                     /note="propagated from UniProtKB/Swiss-Prot (P02528.2);
                     Region: Connecting peptide"
     misc_feature    307..552
                     /gene="Cryge"
                     /gene_synonym="Cryg5; Len"
                     /note="Beta/Gamma crystallin; Region: Crystall; pfam00030"
                     /db_xref="CDD:425430"
     exon            52..294
                     /gene="Cryge"
                     /gene_synonym="Cryg5; Len"
                     /inference="alignment:Splign:2.1.0"
     exon            295..633
                     /gene="Cryge"
                     /gene_synonym="Cryg5; Len"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
acaaccaacagcaccatcccatccgacctgcaaacaacagccatggggaagatcaccttctatgaggaccgcggcttccagggccgccactatgagtgcagcacagaccactccaacctgcagccctacttcagccgctgcaactctgtgcgcgtggacagtggctgctggatgctctatgagcagcccaacttcacaggctgccagtatttccttcgtcgcggggactaccctgactaccagcagtggatgggtttcagcgactctgtccgctcctgccgcctcatcccccactccagctctcacagaatcaggatctacgagcgagaggactacagaggccagatggtggagatcacagacgactgcccccacctgcaggaccgcttccacttcagtgacttccactctttccacgtgatggagggctactgggtcctctatgagatgcccaactaccgggggcggcagtacctgctgaggcctggagaatacaggcgctaccacgactggggcgccatgaatgccagggtaggctctctgaggagaatcatggatttctattgaaatatttttactctaccattttctccatctggacattaataaaatatttcctgtgtgtttcatgca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]