2024-04-30 03:01:35, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_173289 633 bp mRNA linear ROD 19-MAR-2023 DEFINITION Rattus norvegicus crystallin, gamma E (Cryge), mRNA. ACCESSION NM_173289 XM_001081859 VERSION NM_173289.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 633) AUTHORS Kim I, Saito T, Fujii N, Kanamoto T, Chatake T and Fujii N. TITLE Site specific oxidation of amino acid residues in rat lens gamma-crystallin induced by low-dose gamma-irradiation JOURNAL Biochem Biophys Res Commun 466 (4), 622-628 (2015) PUBMED 26385181 REMARK GeneRIF: Specific oxidation sites of methionine, cysteine and tryptophan in water-soluble and -insoluble gammaE and gammaF-crystallin were determined by one-shot analysis after low-dose gamma-irradiation. REFERENCE 2 (bases 1 to 633) AUTHORS Kwitek AE, Gullings-Handley J, Yu J, Carlos DC, Orlebeke K, Nie J, Eckert J, Lemke A, Andrae JW, Bromberg S, Pasko D, Chen D, Scheetz TE, Casavant TL, Soares MB, Sheffield VC, Tonellato PJ and Jacob HJ. TITLE High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence JOURNAL Genome Res 14 (4), 750-757 (2004) PUBMED 15060019 REFERENCE 3 (bases 1 to 633) AUTHORS Norledge BV, Hay RE, Bateman OA, Slingsby C and Driessen HP. TITLE Towards a molecular understanding of phase separation in the lens: a comparison of the X-ray structures of two high Tc gamma-crystallins, gammaE and gammaF, with two low Tc gamma-crystallins, gammaB and gammaD JOURNAL Exp Eye Res 65 (5), 609-630 (1997) PUBMED 9367641 REFERENCE 4 (bases 1 to 633) AUTHORS Voorter CE, De Haard-Hoekman WA, Hermans MM, Bloemendal H and De Jong WW. TITLE Differential synthesis of crystallins in the developing rat eye lens JOURNAL Exp Eye Res 50 (4), 429-437 (1990) PUBMED 2338125 REFERENCE 5 (bases 1 to 633) AUTHORS den Dunnen JT, van Neck JW, Cremers FP, Lubsen NH and Schoenmakers JG. TITLE Nucleotide sequence of the rat gamma-crystallin gene region and comparison with an orthologous human region JOURNAL Gene 78 (2), 201-213 (1989) PUBMED 2777080 REFERENCE 6 (bases 1 to 633) AUTHORS den Dunnen,J.T. and Schoenmakers,J.G. TITLE Consensus sequences of the Rattus norvegicus B1- and B2 repeats JOURNAL Nucleic Acids Res 15 (6), 2772 (1987) PUBMED 3562235 REFERENCE 7 (bases 1 to 633) AUTHORS Moormann,R.J., den Dunnen,J.T., Mulleners,L., Andreoli,P., Bloemendal,H. and Schoenmakers,J.G. TITLE Strict co-linearity of genetic and protein folding domains in an intragenically duplicated rat lens gamma-crystallin gene JOURNAL J Mol Biol 171 (4), 353-368 (1983) PUBMED 6319707 REFERENCE 8 (bases 1 to 633) AUTHORS Moormann,R.J., den Dunnen,J.T., Bloemendal,H. and Schoenmakers,J.G. TITLE Extensive intragenic sequence homology in two distinct rat lens gamma-crystallin cDNAs suggests duplications of a primordial gene JOURNAL Proc Natl Acad Sci U S A 79 (22), 6876-6880 (1982) PUBMED 6294661 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from M19359.1. On Jun 25, 2006 this sequence version replaced XM_001081859.1. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMN06680452, SAMN06680453 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..633 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="9" /map="9q32" gene 1..633 /gene="Cryge" /gene_synonym="Cryg5; Len" /note="crystallin, gamma E" /db_xref="GeneID:24279" /db_xref="RGD:2423" exon 1..51 /gene="Cryge" /gene_synonym="Cryg5; Len" /inference="alignment:Splign:2.1.0" CDS 43..567 /gene="Cryge" /gene_synonym="Cryg5; Len" /note="gamma-2; gamma-E-crystallin; gamma-crystallin 3-1; Crystallin, gamma polypeptide 5; gamma-crystallin D-like" /codon_start=1 /product="gamma-crystallin E" /protein_id="NP_775411.1" /db_xref="GeneID:24279" /db_xref="RGD:2423" /translation="
MGKITFYEDRGFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWMLYEQPNFTGCQYFLRRGDYPDYQQWMGFSDSVRSCRLIPHSSSHRIRIYEREDYRGQMVEITDDCPHLQDRFHFSDFHSFHVMEGYWVLYEMPNYRGRQYLLRPGEYRRYHDWGAMNARVGSLRRIMDFY"
misc_feature 49..288 /gene="Cryge" /gene_synonym="Cryg5; Len" /note="Beta/gamma crystallins; Region: XTALbg; smart00247" /db_xref="CDD:214583" misc_feature 292..303 /gene="Cryge" /gene_synonym="Cryg5; Len" /note="propagated from UniProtKB/Swiss-Prot (P02528.2); Region: Connecting peptide" misc_feature 307..552 /gene="Cryge" /gene_synonym="Cryg5; Len" /note="Beta/Gamma crystallin; Region: Crystall; pfam00030" /db_xref="CDD:425430" exon 52..294 /gene="Cryge" /gene_synonym="Cryg5; Len" /inference="alignment:Splign:2.1.0" exon 295..633 /gene="Cryge" /gene_synonym="Cryg5; Len" /inference="alignment:Splign:2.1.0" ORIGIN
acaaccaacagcaccatcccatccgacctgcaaacaacagccatggggaagatcaccttctatgaggaccgcggcttccagggccgccactatgagtgcagcacagaccactccaacctgcagccctacttcagccgctgcaactctgtgcgcgtggacagtggctgctggatgctctatgagcagcccaacttcacaggctgccagtatttccttcgtcgcggggactaccctgactaccagcagtggatgggtttcagcgactctgtccgctcctgccgcctcatcccccactccagctctcacagaatcaggatctacgagcgagaggactacagaggccagatggtggagatcacagacgactgcccccacctgcaggaccgcttccacttcagtgacttccactctttccacgtgatggagggctactgggtcctctatgagatgcccaactaccgggggcggcagtacctgctgaggcctggagaatacaggcgctaccacgactggggcgccatgaatgccagggtaggctctctgaggagaatcatggatttctattgaaatatttttactctaccattttctccatctggacattaataaaatatttcctgtgtgtttcatgca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]