GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 02:57:04, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_172077                907 bp    mRNA    linear   ROD 04-MAR-2023
DEFINITION  Rattus norvegicus regenerating islet-derived 3 alpha (Reg3a),
            transcript variant 1, mRNA.
ACCESSION   NM_172077
VERSION     NM_172077.2
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 907)
  AUTHORS   Reding T, Palmiere C, Pazhepurackel C, Schiesser M, Bimmler D,
            Schlegel A, Suss U, Steiner S, Mancina L, Seleznik G and Graf R.
  TITLE     The pancreas responds to remote damage and systemic stress by
            secretion of the pancreatic secretory proteins PSP/regI and
            PAP/regIII
  JOURNAL   Oncotarget 8 (18), 30162-30174 (2017)
   PUBMED   28415799
  REMARK    GeneRIF: The pancreas reacts to remote lesions and septic insults
            in mice and rats with increased PSP synthesis, while PAP is
            selectively responsive to septic events. Furthermore, our results
            suggest that serum PSP in septic patients is predominantly derived
            through an acute phase response of the pancreas.
REFERENCE   2  (bases 1 to 907)
  AUTHORS   Coffey R, Nam H and Knutson MD.
  TITLE     Microarray analysis of rat pancreas reveals altered expression of
            Alox15 and regenerating islet-derived genes in response to iron
            deficiency and overload
  JOURNAL   PLoS One 9 (1), e86019 (2014)
   PUBMED   24465846
  REMARK    GeneRIF: Alox15 mRNA levels were 4 times higher in iron-deficient
            than in iron-adequate pancreas and that Reg1a, Reg3a, and Reg3b
            mRNA levels were 17-36 times higher in iron-overloaded pancreas.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 907)
  AUTHORS   Li B, Lu Y, Srikant CB, Gao ZH and Liu JL.
  TITLE     Intestinal adaptation and Reg gene expression induced by
            antidiabetic duodenal-jejunal bypass surgery in Zucker fatty rats
  JOURNAL   Am J Physiol Gastrointest Liver Physiol 304 (7), G635-G645 (2013)
   PUBMED   23370676
  REMARK    GeneRIF: After duodenal-jejunal bypass, the level of Reg3alpha and
            -3beta were not changed in bypassed duodenum in morbidly obese
            Zucker fatty rats.
REFERENCE   4  (bases 1 to 907)
  AUTHORS   Madrid V, Borelli MI, Maiztegui B, Flores LE, Gagliardino JJ and
            Zotto HD.
  TITLE     Islet neogenesis-associated protein (INGAP)-positive cell mass,
            beta-cell mass, and insulin secretion: their relationship during
            the fetal and neonatal periods
  JOURNAL   Pancreas 42 (3), 422-428 (2013)
   PUBMED   23303201
  REMARK    GeneRIF: Findings suggest that islet neogenesis-associated protein
            (INGAP) exerts a positive modulatory effect on beta-cell mass and
            its secretory function in fetal and neonatal rats, thus becoming a
            new component in the multifactorial regulation of such processes.
REFERENCE   5  (bases 1 to 907)
  AUTHORS   Lai Y, Li D, Li C, Muehleisen B, Radek KA, Park HJ, Jiang Z, Li Z,
            Lei H, Quan Y, Zhang T, Wu Y, Kotol P, Morizane S, Hata TR,
            Iwatsuki K, Tang C and Gallo RL.
  TITLE     The antimicrobial protein REG3A regulates keratinocyte
            proliferation and differentiation after skin injury
  JOURNAL   Immunity 37 (1), 74-84 (2012)
   PUBMED   22727489
REFERENCE   6  (bases 1 to 907)
  AUTHORS   Viterbo D, Bluth MH, Lin YY, Mueller CM, Wadgaonkar R and Zenilman
            ME.
  TITLE     Pancreatitis-associated protein 2 modulates inflammatory responses
            in macrophages
  JOURNAL   J Immunol 181 (3), 1948-1958 (2008)
   PUBMED   18641332
  REMARK    GeneRIF: Pancreatitis-associated protein 2 stimulates macrophage
            activity and likely modulates the inflammatory environment of
            pancreatitis
REFERENCE   7  (bases 1 to 907)
  AUTHORS   Lin YY, Viterbo D, Mueller CM, Stanek AE, Smith-Norowitz T, Drew H,
            Wadgaonkar R, Zenilman ME and Bluth MH.
  TITLE     Small-interference RNA gene knockdown of pancreatitis-associated
            proteins in rat acute pancreatitis
  JOURNAL   Pancreas 36 (4), 402-410 (2008)
   PUBMED   18437087
  REMARK    GeneRIF: Small interfering RNA-mediated gene knockdown of PAP
            worsens pancreatitis. Differences in gene knockdown technology may
            provide different approaches to study gene function.
REFERENCE   8  (bases 1 to 907)
  AUTHORS   Bimmler D, Schiesser M, Perren A, Scheele G, Angst E, Meili S,
            Ammann R and Graf R.
  TITLE     Coordinate regulation of PSP/reg and PAP isoforms as a family of
            secretory stress proteins in an animal model of chronic
            pancreatitis
  JOURNAL   J Surg Res 118 (2), 122-135 (2004)
   PUBMED   15100001
  REMARK    GeneRIF: There is a tight spatial and temporal association between
            pre-inflammatory changes or inflammation and PAP-expression.
REFERENCE   9  (bases 1 to 907)
  AUTHORS   Suzuki Y, Yonekura H, Watanabe T, Unno M, Moriizumi S, Miyashita H
            and Okamoto H.
  TITLE     Structure and expression of a novel rat RegIII gene
  JOURNAL   Gene 144 (2), 315-316 (1994)
   PUBMED   8039722
REFERENCE   10 (bases 1 to 907)
  AUTHORS   Frigerio JM, Dusetti NJ, Keim V, Dagorn JC and Iovanna JL.
  TITLE     Identification of a second rat pancreatitis-associated protein.
            Messenger RNA cloning, gene structure, and expression during acute
            pancreatitis
  JOURNAL   Biochemistry 32 (35), 9236-9241 (1993)
   PUBMED   8369291
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            L10229.1, CF249035.1 and AW532201.1.
            
            On Mar 31, 2009 this sequence version replaced NM_172077.1.
            
            Transcript Variant: This variant (1) represents the longer
            transcript. Both variants 1 and 2 encode the same protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: L10229.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA5756307, SAMEA5760393
                                           [ECO:0000350]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-465               L10229.1           1-465
            466-602             CF249035.1         353-489
            603-881             L10229.1           603-881
            882-907             AW532201.1         1-26                c
FEATURES             Location/Qualifiers
     source          1..907
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q33"
     gene            1..907
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /note="regenerating islet-derived 3 alpha"
                     /db_xref="GeneID:171162"
                     /db_xref="RGD:621401"
     exon            1..22
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /inference="alignment:Splign:2.1.0"
     exon            23..229
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    112..114
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /note="upstream in-frame stop codon"
     CDS             157..681
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /note="regenerating islet-derived protein 3-alpha; REG 3;
                     regIII; reg III-alpha; lithostathine 3;
                     pancreatitis-associated protein 2; islet of Langerhans
                     regenerating protein 3; REG-3-alpha; regenerating
                     islet-derived protein III-alpha"
                     /codon_start=1
                     /product="regenerating islet-derived protein 3-alpha
                     precursor"
                     /protein_id="NP_742074.2"
                     /db_xref="GeneID:171162"
                     /db_xref="RGD:621401"
                     /translation="
MLPRLSFNNVSWTLLYYLFIFQVRGEDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ"
     sig_peptide     157..231
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    271..672
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cl02432"
                     /db_xref="CDD:445781"
     misc_feature    460..507
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /note="propagated from UniProtKB/Swiss-Prot (P35231.1);
                     Region: Sufficient to activate EXTL3.
                     /evidence=ECO:0000250|UniProtKB:Q06141"
     misc_feature    order(583..585,595..597,601..603,622..624,628..639,
                     646..654)
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
     exon            230..348
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /inference="alignment:Splign:2.1.0"
     exon            349..486
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /inference="alignment:Splign:2.1.0"
     exon            487..613
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /inference="alignment:Splign:2.1.0"
     exon            614..890
                     /gene="Reg3a"
                     /gene_synonym="Pap2; PapII"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atcccagatcactgcaaggcagaccttagcaaagcagagatggggctaagactagtgtatccctgaagacctaggcaaagggagagagggccctcgtttgcttgttctcgttgactacactctctgtgccctgtttgctgcttccttgaagacaagatgctgcctcgtctgtccttcaacaatgtgtcctggacgctgctctactacctgttcatatttcaggtacgaggtgaagactcccagaaggcagtgccctctacacgaaccagctgccccatgggctccaaggcttatcgttcttactgctataccttggtcacgacactcaaatcctggtttcaagcagatctggcctgccagaagagaccttcaggacaccttgtgtctattcttagtggaggtgaggcttcctttgtgtcttccctggtgacaggcagagtgaacaacaaccaagacatctggattgggctccatgatccaacaatgggtcaacaacccaatggaggtggatgggagtggagtaactctgacgtactgaattatctcaactgggatggggatccttcctctactgtcaaccgtggtaactgtggcagtctaacagctacctcggagtttctgaagtggggagaccatcactgtgatgtggaattaccttttgtctgcaagttcaagcagtagacccgcagcatcctgagtttatcatgaaggtcaccgtgacaagggatgtacatgacaaggctgtacttgcttcacagtcctgcatcagacttgctgttatgattttccatcttccttcatccgttttcttccccccatttcaggctttttttggtatagttcctgctttgcaatcttgaagataaataatacataaaatcttttattttaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]