2024-04-30 13:19:38, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_172077 907 bp mRNA linear ROD 04-MAR-2023 DEFINITION Rattus norvegicus regenerating islet-derived 3 alpha (Reg3a), transcript variant 1, mRNA. ACCESSION NM_172077 VERSION NM_172077.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 907) AUTHORS Reding T, Palmiere C, Pazhepurackel C, Schiesser M, Bimmler D, Schlegel A, Suss U, Steiner S, Mancina L, Seleznik G and Graf R. TITLE The pancreas responds to remote damage and systemic stress by secretion of the pancreatic secretory proteins PSP/regI and PAP/regIII JOURNAL Oncotarget 8 (18), 30162-30174 (2017) PUBMED 28415799 REMARK GeneRIF: The pancreas reacts to remote lesions and septic insults in mice and rats with increased PSP synthesis, while PAP is selectively responsive to septic events. Furthermore, our results suggest that serum PSP in septic patients is predominantly derived through an acute phase response of the pancreas. REFERENCE 2 (bases 1 to 907) AUTHORS Coffey R, Nam H and Knutson MD. TITLE Microarray analysis of rat pancreas reveals altered expression of Alox15 and regenerating islet-derived genes in response to iron deficiency and overload JOURNAL PLoS One 9 (1), e86019 (2014) PUBMED 24465846 REMARK GeneRIF: Alox15 mRNA levels were 4 times higher in iron-deficient than in iron-adequate pancreas and that Reg1a, Reg3a, and Reg3b mRNA levels were 17-36 times higher in iron-overloaded pancreas. Publication Status: Online-Only REFERENCE 3 (bases 1 to 907) AUTHORS Li B, Lu Y, Srikant CB, Gao ZH and Liu JL. TITLE Intestinal adaptation and Reg gene expression induced by antidiabetic duodenal-jejunal bypass surgery in Zucker fatty rats JOURNAL Am J Physiol Gastrointest Liver Physiol 304 (7), G635-G645 (2013) PUBMED 23370676 REMARK GeneRIF: After duodenal-jejunal bypass, the level of Reg3alpha and -3beta were not changed in bypassed duodenum in morbidly obese Zucker fatty rats. REFERENCE 4 (bases 1 to 907) AUTHORS Madrid V, Borelli MI, Maiztegui B, Flores LE, Gagliardino JJ and Zotto HD. TITLE Islet neogenesis-associated protein (INGAP)-positive cell mass, beta-cell mass, and insulin secretion: their relationship during the fetal and neonatal periods JOURNAL Pancreas 42 (3), 422-428 (2013) PUBMED 23303201 REMARK GeneRIF: Findings suggest that islet neogenesis-associated protein (INGAP) exerts a positive modulatory effect on beta-cell mass and its secretory function in fetal and neonatal rats, thus becoming a new component in the multifactorial regulation of such processes. REFERENCE 5 (bases 1 to 907) AUTHORS Lai Y, Li D, Li C, Muehleisen B, Radek KA, Park HJ, Jiang Z, Li Z, Lei H, Quan Y, Zhang T, Wu Y, Kotol P, Morizane S, Hata TR, Iwatsuki K, Tang C and Gallo RL. TITLE The antimicrobial protein REG3A regulates keratinocyte proliferation and differentiation after skin injury JOURNAL Immunity 37 (1), 74-84 (2012) PUBMED 22727489 REFERENCE 6 (bases 1 to 907) AUTHORS Viterbo D, Bluth MH, Lin YY, Mueller CM, Wadgaonkar R and Zenilman ME. TITLE Pancreatitis-associated protein 2 modulates inflammatory responses in macrophages JOURNAL J Immunol 181 (3), 1948-1958 (2008) PUBMED 18641332 REMARK GeneRIF: Pancreatitis-associated protein 2 stimulates macrophage activity and likely modulates the inflammatory environment of pancreatitis REFERENCE 7 (bases 1 to 907) AUTHORS Lin YY, Viterbo D, Mueller CM, Stanek AE, Smith-Norowitz T, Drew H, Wadgaonkar R, Zenilman ME and Bluth MH. TITLE Small-interference RNA gene knockdown of pancreatitis-associated proteins in rat acute pancreatitis JOURNAL Pancreas 36 (4), 402-410 (2008) PUBMED 18437087 REMARK GeneRIF: Small interfering RNA-mediated gene knockdown of PAP worsens pancreatitis. Differences in gene knockdown technology may provide different approaches to study gene function. REFERENCE 8 (bases 1 to 907) AUTHORS Bimmler D, Schiesser M, Perren A, Scheele G, Angst E, Meili S, Ammann R and Graf R. TITLE Coordinate regulation of PSP/reg and PAP isoforms as a family of secretory stress proteins in an animal model of chronic pancreatitis JOURNAL J Surg Res 118 (2), 122-135 (2004) PUBMED 15100001 REMARK GeneRIF: There is a tight spatial and temporal association between pre-inflammatory changes or inflammation and PAP-expression. REFERENCE 9 (bases 1 to 907) AUTHORS Suzuki Y, Yonekura H, Watanabe T, Unno M, Moriizumi S, Miyashita H and Okamoto H. TITLE Structure and expression of a novel rat RegIII gene JOURNAL Gene 144 (2), 315-316 (1994) PUBMED 8039722 REFERENCE 10 (bases 1 to 907) AUTHORS Frigerio JM, Dusetti NJ, Keim V, Dagorn JC and Iovanna JL. TITLE Identification of a second rat pancreatitis-associated protein. Messenger RNA cloning, gene structure, and expression during acute pancreatitis JOURNAL Biochemistry 32 (35), 9236-9241 (1993) PUBMED 8369291 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from L10229.1, CF249035.1 and AW532201.1. On Mar 31, 2009 this sequence version replaced NM_172077.1. Transcript Variant: This variant (1) represents the longer transcript. Both variants 1 and 2 encode the same protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: L10229.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support SAMEA5756307, SAMEA5760393 [ECO:0000350] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-465 L10229.1 1-465 466-602 CF249035.1 353-489 603-881 L10229.1 603-881 882-907 AW532201.1 1-26 c FEATURES Location/Qualifiers source 1..907 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="Sprague-Dawley" /db_xref="taxon:10116" /chromosome="4" /map="4q33" gene 1..907 /gene="Reg3a" /gene_synonym="Pap2; PapII" /note="regenerating islet-derived 3 alpha" /db_xref="GeneID:171162" /db_xref="RGD:621401" exon 1..22 /gene="Reg3a" /gene_synonym="Pap2; PapII" /inference="alignment:Splign:2.1.0" exon 23..229 /gene="Reg3a" /gene_synonym="Pap2; PapII" /inference="alignment:Splign:2.1.0" misc_feature 112..114 /gene="Reg3a" /gene_synonym="Pap2; PapII" /note="upstream in-frame stop codon" CDS 157..681 /gene="Reg3a" /gene_synonym="Pap2; PapII" /note="regenerating islet-derived protein 3-alpha; REG 3; regIII; reg III-alpha; lithostathine 3; pancreatitis-associated protein 2; islet of Langerhans regenerating protein 3; REG-3-alpha; regenerating islet-derived protein III-alpha" /codon_start=1 /product="regenerating islet-derived protein 3-alpha precursor" /protein_id="NP_742074.2" /db_xref="GeneID:171162" /db_xref="RGD:621401" /translation="
MLPRLSFNNVSWTLLYYLFIFQVRGEDSQKAVPSTRTSCPMGSKAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGNCGSLTATSEFLKWGDHHCDVELPFVCKFKQ"
sig_peptide 157..231 /gene="Reg3a" /gene_synonym="Pap2; PapII" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 271..672 /gene="Reg3a" /gene_synonym="Pap2; PapII" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cl02432" /db_xref="CDD:445781" misc_feature 460..507 /gene="Reg3a" /gene_synonym="Pap2; PapII" /note="propagated from UniProtKB/Swiss-Prot (P35231.1); Region: Sufficient to activate EXTL3. /evidence=ECO:0000250|UniProtKB:Q06141" misc_feature order(583..585,595..597,601..603,622..624,628..639, 646..654) /gene="Reg3a" /gene_synonym="Pap2; PapII" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" exon 230..348 /gene="Reg3a" /gene_synonym="Pap2; PapII" /inference="alignment:Splign:2.1.0" exon 349..486 /gene="Reg3a" /gene_synonym="Pap2; PapII" /inference="alignment:Splign:2.1.0" exon 487..613 /gene="Reg3a" /gene_synonym="Pap2; PapII" /inference="alignment:Splign:2.1.0" exon 614..890 /gene="Reg3a" /gene_synonym="Pap2; PapII" /inference="alignment:Splign:2.1.0" ORIGIN
atcccagatcactgcaaggcagaccttagcaaagcagagatggggctaagactagtgtatccctgaagacctaggcaaagggagagagggccctcgtttgcttgttctcgttgactacactctctgtgccctgtttgctgcttccttgaagacaagatgctgcctcgtctgtccttcaacaatgtgtcctggacgctgctctactacctgttcatatttcaggtacgaggtgaagactcccagaaggcagtgccctctacacgaaccagctgccccatgggctccaaggcttatcgttcttactgctataccttggtcacgacactcaaatcctggtttcaagcagatctggcctgccagaagagaccttcaggacaccttgtgtctattcttagtggaggtgaggcttcctttgtgtcttccctggtgacaggcagagtgaacaacaaccaagacatctggattgggctccatgatccaacaatgggtcaacaacccaatggaggtggatgggagtggagtaactctgacgtactgaattatctcaactgggatggggatccttcctctactgtcaaccgtggtaactgtggcagtctaacagctacctcggagtttctgaagtggggagaccatcactgtgatgtggaattaccttttgtctgcaagttcaagcagtagacccgcagcatcctgagtttatcatgaaggtcaccgtgacaagggatgtacatgacaaggctgtacttgcttcacagtcctgcatcagacttgctgttatgattttccatcttccttcatccgttttcttccccccatttcaggctttttttggtatagttcctgctttgcaatcttgaagataaataatacataaaatcttttattttaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]