GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 00:44:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_053577                947 bp    mRNA    linear   ROD 12-NOV-2023
DEFINITION  Rattus norvegicus secreted phosphoprotein 2 (Spp2), mRNA.
ACCESSION   NM_053577 XM_343622
VERSION     NM_053577.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 947)
  AUTHORS   Barallobre-Barreiro J, Gupta SK, Zoccarato A, Kitazume-Taneike R,
            Fava M, Yin X, Werner T, Hirt MN, Zampetaki A, Viviano A, Chong M,
            Bern M, Kourliouros A, Domenech N, Willeit P, Shah AM, Jahangiri M,
            Schaefer L, Fischer JW, Iozzo RV, Viner R, Thum T, Heineke J,
            Kichler A, Otsu K and Mayr M.
  TITLE     Glycoproteomics Reveals Decorin Peptides With Anti-Myostatin
            Activity in Human Atrial Fibrillation
  JOURNAL   Circulation 134 (11), 817-832 (2016)
   PUBMED   27559042
REFERENCE   2  (bases 1 to 947)
  AUTHORS   Bennett CS, Khorram Khorshid HR, Kitchen JA, Arteta D and Dalgleish
            R.
  TITLE     Characterization of the human secreted phosphoprotein 24 gene
            (SPP2) and comparison of the protein sequence in nine species
  JOURNAL   Matrix Biol 22 (8), 641-651 (2004)
   PUBMED   15062857
REFERENCE   3  (bases 1 to 947)
  AUTHORS   Price PA, Nguyen TM and Williamson MK.
  TITLE     Biochemical characterization of the serum fetuin-mineral complex
  JOURNAL   J Biol Chem 278 (24), 22153-22160 (2003)
   PUBMED   12676928
REFERENCE   4  (bases 1 to 947)
  AUTHORS   Kanematsu T, Misumi Y, Watanabe Y, Ozaki S, Koga T, Iwanaga S,
            Ikehara Y and Hirata M.
  TITLE     A new inositol 1,4,5-trisphosphate binding protein similar to
            phospholipase C-delta 1
  JOURNAL   Biochem J 313 (Pt 1) (Pt 1), 319-325 (1996)
   PUBMED   8546702
REFERENCE   5  (bases 1 to 947)
  AUTHORS   Hu B, Coulson L, Moyer B and Price PA.
  TITLE     Isolation and molecular cloning of a novel bone phosphoprotein
            related in sequence to the cystatin family of thiol protease
            inhibitors
  JOURNAL   J Biol Chem 270 (1), 431-436 (1995)
   PUBMED   7814406
  REMARK    Erratum:[J Biol Chem 1995 Apr 28;270(17):10359]
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC088193.1.
            
            On Jan 3, 2005 this sequence version replaced XM_343622.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC088193.1, FQ210198.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132267, SAMD00132286
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..947
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="9"
                     /map="9q35"
     gene            1..947
                     /gene="Spp2"
                     /note="secreted phosphoprotein 2"
                     /db_xref="GeneID:94168"
                     /db_xref="RGD:708488"
     exon            1..217
                     /gene="Spp2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    28..30
                     /gene="Spp2"
                     /note="upstream in-frame stop codon"
     CDS             151..762
                     /gene="Spp2"
                     /note="secreted phosphoprotein 24; secreted phosphoprotein
                     2, 24kDa; spp-24"
                     /codon_start=1
                     /product="secreted phosphoprotein 24 precursor"
                     /protein_id="NP_446029.1"
                     /db_xref="GeneID:94168"
                     /db_xref="RGD:708488"
                     /translation="
MELATMKTLVMLVLGMHYWCASGFPVYDYDPSSLQEALSASVAKVNSQSLSPYLFRATRSSLKRVNVLDEDTLVMNLEFTVQETTCLRESGDPSTCAFQRGYSVPTAACRSTVQMSKGQVKDVWAHCRWASTSESNSSEEMIFGDMARSHRRRNDYLLGFLYDEPKGEQFYDRSIEITRRGHPPAHRRFLNLQRRARVNSGFE"
     sig_peptide     151..219
                     /gene="Spp2"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     220..759
                     /gene="Spp2"
                     /product="Secreted phosphoprotein 24. /id=PRO_0000072146"
                     /note="propagated from UniProtKB/Swiss-Prot (Q62740.2)"
     misc_feature    244..450
                     /gene="Spp2"
                     /note="Cystatin-like domain; Cystatins are a family of
                     cysteine protease inhibitors that occur mainly as single
                     domain proteins. However some extracellular proteins such
                     as kininogen, His-rich glycoprotein and fetuin also
                     contain these domains; Region: CY; cl09238"
                     /db_xref="CDD:447698"
     misc_feature    349..537
                     /gene="Spp2"
                     /note="Secreted phosphoprotein 24 (Spp-24) cystatin-like
                     domain; Region: Spp-24; pfam07448"
                     /db_xref="CDD:429466"
     misc_feature    418..420
                     /gene="Spp2"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:Q13103; propagated from
                     UniProtKB/Swiss-Prot (Q62740.2); phosphorylation site"
     misc_feature    559..561
                     /gene="Spp2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62740.2); phosphorylation site"
     misc_feature    562..564
                     /gene="Spp2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62740.2); phosphorylation site"
     misc_feature    670..672
                     /gene="Spp2"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q62740.2); phosphorylation site"
     exon            218..342
                     /gene="Spp2"
                     /inference="alignment:Splign:2.1.0"
     exon            343..462
                     /gene="Spp2"
                     /inference="alignment:Splign:2.1.0"
     exon            463..570
                     /gene="Spp2"
                     /inference="alignment:Splign:2.1.0"
     exon            571..625
                     /gene="Spp2"
                     /inference="alignment:Splign:2.1.0"
     exon            626..676
                     /gene="Spp2"
                     /inference="alignment:Splign:2.1.0"
     exon            677..772
                     /gene="Spp2"
                     /inference="alignment:Splign:2.1.0"
     exon            773..879
                     /gene="Spp2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
attgacacgggaatcaatcatctctactgaggttccagactgcttcagccagccagggcagctaggtcgcaggtgacaaggataagacagtcaccctcggaaagagctgtagagaggccatctccttggctctgggtcgccgtcctcgggatggagctggcaacgatgaagacgctggttatgttggtgctgggaatgcactactggtgtgcctcaggtttcccggtgtacgactacgacccttcctctctgcaagaagctctcagtgcctcagtggctaaggtgaactcgcaatccctgagtccttacctgtttcgggcgacgcggagctccctgaagagagttaatgtcctggatgaagacacactggtcatgaacttagagttcaccgttcaggaaactacatgcctaagagagtctggtgatccctccacctgcgccttccaaaggggctactctgtgccaacagctgcttgcaggagcacagtgcagatgtccaagggacaggtgaaggatgtgtgggctcactgccgctgggcgtccacatccgagtccaacagcagtgaggagatgatttttggggacatggcaagatcccaccgacgaagaaatgattatctacttggctttctttatgatgaacccaaaggtgagcagttctatgaccggtcgattgagatcacgaggaggggacatcctcctgcccatagaaggttcctgaacctccaacgcagagcaagagtcaattctggctttgagtgacatcctggagattccatgaaagaaagagaagcagaagctgaaatgaaggacatggagaattgtgtctttttcctttgataagctccactttgcaataaagatcttccccttcctgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]