2024-05-04 17:19:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_053577 947 bp mRNA linear ROD 12-NOV-2023 DEFINITION Rattus norvegicus secreted phosphoprotein 2 (Spp2), mRNA. ACCESSION NM_053577 XM_343622 VERSION NM_053577.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 947) AUTHORS Barallobre-Barreiro J, Gupta SK, Zoccarato A, Kitazume-Taneike R, Fava M, Yin X, Werner T, Hirt MN, Zampetaki A, Viviano A, Chong M, Bern M, Kourliouros A, Domenech N, Willeit P, Shah AM, Jahangiri M, Schaefer L, Fischer JW, Iozzo RV, Viner R, Thum T, Heineke J, Kichler A, Otsu K and Mayr M. TITLE Glycoproteomics Reveals Decorin Peptides With Anti-Myostatin Activity in Human Atrial Fibrillation JOURNAL Circulation 134 (11), 817-832 (2016) PUBMED 27559042 REFERENCE 2 (bases 1 to 947) AUTHORS Bennett CS, Khorram Khorshid HR, Kitchen JA, Arteta D and Dalgleish R. TITLE Characterization of the human secreted phosphoprotein 24 gene (SPP2) and comparison of the protein sequence in nine species JOURNAL Matrix Biol 22 (8), 641-651 (2004) PUBMED 15062857 REFERENCE 3 (bases 1 to 947) AUTHORS Price PA, Nguyen TM and Williamson MK. TITLE Biochemical characterization of the serum fetuin-mineral complex JOURNAL J Biol Chem 278 (24), 22153-22160 (2003) PUBMED 12676928 REFERENCE 4 (bases 1 to 947) AUTHORS Kanematsu T, Misumi Y, Watanabe Y, Ozaki S, Koga T, Iwanaga S, Ikehara Y and Hirata M. TITLE A new inositol 1,4,5-trisphosphate binding protein similar to phospholipase C-delta 1 JOURNAL Biochem J 313 (Pt 1) (Pt 1), 319-325 (1996) PUBMED 8546702 REFERENCE 5 (bases 1 to 947) AUTHORS Hu B, Coulson L, Moyer B and Price PA. TITLE Isolation and molecular cloning of a novel bone phosphoprotein related in sequence to the cystatin family of thiol protease inhibitors JOURNAL J Biol Chem 270 (1), 431-436 (1995) PUBMED 7814406 REMARK Erratum:[J Biol Chem 1995 Apr 28;270(17):10359] COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC088193.1. On Jan 3, 2005 this sequence version replaced XM_343622.1. ##Evidence-Data-START## Transcript exon combination :: BC088193.1, FQ210198.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132267, SAMD00132286 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..947 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="9" /map="9q35" gene 1..947 /gene="Spp2" /note="secreted phosphoprotein 2" /db_xref="GeneID:94168" /db_xref="RGD:708488" exon 1..217 /gene="Spp2" /inference="alignment:Splign:2.1.0" misc_feature 28..30 /gene="Spp2" /note="upstream in-frame stop codon" CDS 151..762 /gene="Spp2" /note="secreted phosphoprotein 24; secreted phosphoprotein 2, 24kDa; spp-24" /codon_start=1 /product="secreted phosphoprotein 24 precursor" /protein_id="NP_446029.1" /db_xref="GeneID:94168" /db_xref="RGD:708488" /translation="
MELATMKTLVMLVLGMHYWCASGFPVYDYDPSSLQEALSASVAKVNSQSLSPYLFRATRSSLKRVNVLDEDTLVMNLEFTVQETTCLRESGDPSTCAFQRGYSVPTAACRSTVQMSKGQVKDVWAHCRWASTSESNSSEEMIFGDMARSHRRRNDYLLGFLYDEPKGEQFYDRSIEITRRGHPPAHRRFLNLQRRARVNSGFE"
sig_peptide 151..219 /gene="Spp2" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 220..759 /gene="Spp2" /product="Secreted phosphoprotein 24. /id=PRO_0000072146" /note="propagated from UniProtKB/Swiss-Prot (Q62740.2)" misc_feature 244..450 /gene="Spp2" /note="Cystatin-like domain; Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains; Region: CY; cl09238" /db_xref="CDD:447698" misc_feature 349..537 /gene="Spp2" /note="Secreted phosphoprotein 24 (Spp-24) cystatin-like domain; Region: Spp-24; pfam07448" /db_xref="CDD:429466" misc_feature 418..420 /gene="Spp2" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:Q13103; propagated from UniProtKB/Swiss-Prot (Q62740.2); phosphorylation site" misc_feature 559..561 /gene="Spp2" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (Q62740.2); phosphorylation site" misc_feature 562..564 /gene="Spp2" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (Q62740.2); phosphorylation site" misc_feature 670..672 /gene="Spp2" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (Q62740.2); phosphorylation site" exon 218..342 /gene="Spp2" /inference="alignment:Splign:2.1.0" exon 343..462 /gene="Spp2" /inference="alignment:Splign:2.1.0" exon 463..570 /gene="Spp2" /inference="alignment:Splign:2.1.0" exon 571..625 /gene="Spp2" /inference="alignment:Splign:2.1.0" exon 626..676 /gene="Spp2" /inference="alignment:Splign:2.1.0" exon 677..772 /gene="Spp2" /inference="alignment:Splign:2.1.0" exon 773..879 /gene="Spp2" /inference="alignment:Splign:2.1.0" ORIGIN
attgacacgggaatcaatcatctctactgaggttccagactgcttcagccagccagggcagctaggtcgcaggtgacaaggataagacagtcaccctcggaaagagctgtagagaggccatctccttggctctgggtcgccgtcctcgggatggagctggcaacgatgaagacgctggttatgttggtgctgggaatgcactactggtgtgcctcaggtttcccggtgtacgactacgacccttcctctctgcaagaagctctcagtgcctcagtggctaaggtgaactcgcaatccctgagtccttacctgtttcgggcgacgcggagctccctgaagagagttaatgtcctggatgaagacacactggtcatgaacttagagttcaccgttcaggaaactacatgcctaagagagtctggtgatccctccacctgcgccttccaaaggggctactctgtgccaacagctgcttgcaggagcacagtgcagatgtccaagggacaggtgaaggatgtgtgggctcactgccgctgggcgtccacatccgagtccaacagcagtgaggagatgatttttggggacatggcaagatcccaccgacgaagaaatgattatctacttggctttctttatgatgaacccaaaggtgagcagttctatgaccggtcgattgagatcacgaggaggggacatcctcctgcccatagaaggttcctgaacctccaacgcagagcaagagtcaattctggctttgagtgacatcctggagattccatgaaagaaagagaagcagaagctgaaatgaaggacatggagaattgtgtctttttcctttgataagctccactttgcaataaagatcttccccttcctgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]