LOCUS       NM_033483                617 bp    mRNA    linear   ROD 17-DEC-2022
DEFINITION  Rattus norvegicus crystallin, gamma C (Crygc), transcript variant
            1, mRNA.
ACCESSION   NM_033483 XM_001072287 XM_343582
VERSION     NM_033483.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 617)
  AUTHORS   Yao K, Jin C, Zhu N, Wang W, Wu R, Jiang J and Shentu X.
  TITLE     A nonsense mutation in CRYGC associated with autosomal dominant
            congenital nuclear cataract in a Chinese family
  JOURNAL   Mol Vis 14, 1272-1276 (2008)
   PUBMED   18618005
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 617)
  AUTHORS   Muller C, Wohlke A and Distl O.
  TITLE     Evaluation of three canine gamma-crystallins (CRYGB, CRYGC, and
            CRYGS) as candidates for hereditary cataracts in the dachshund
  JOURNAL   Mol Vis 13, 125-132 (2007)
   PUBMED   17327821
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 617)
  AUTHORS   Organisciak D, Darrow R, Gu X, Barsalou L and Crabb JW.
  TITLE     Genetic, age and light mediated effects on crystallin protein
            expression in the retina
  JOURNAL   Photochem Photobiol 82 (4), 1088-1096 (2006)
   PUBMED   16602829
REFERENCE   4  (bases 1 to 617)
  AUTHORS   Pigaga V and Quinlan RA.
  TITLE     Lenticular chaperones suppress the aggregation of the
            cataract-causing mutant T5P gamma C-crystallin
  JOURNAL   Exp Cell Res 312 (1), 51-62 (2006)
   PUBMED   16303126
REFERENCE   5  (bases 1 to 617)
  AUTHORS   Graw J, Neuhauser-Klaus A, Klopp N, Selby PB, Loster J and Favor J.
  TITLE     Genetic and allelic heterogeneity of Cryg mutations in eight
            distinct forms of dominant cataract in the mouse
  JOURNAL   Invest Ophthalmol Vis Sci 45 (4), 1202-1213 (2004)
   PUBMED   15037589
REFERENCE   6  (bases 1 to 617)
  AUTHORS   Szpirer C, Szpirer J, Van Vooren P, Tissir F, Simon JS, Koike G,
            Jacob HJ, Lander ES, Helou K, Klinga-Levan K and Levan G.
  TITLE     Gene-based anchoring of the rat genetic linkage and cytogenetic
            maps: new regional localizations, orientation of the linkage
            groups, and insights into mammalian chromosome evolution
  JOURNAL   Mamm Genome 9 (9), 721-734 (1998)
   PUBMED   9716657
REFERENCE   7  (bases 1 to 617)
  AUTHORS   Voorter CE, De Haard-Hoekman WA, Hermans MM, Bloemendal H and De
            Jong WW.
  TITLE     Differential synthesis of crystallins in the developing rat eye
            lens
  JOURNAL   Exp Eye Res 50 (4), 429-437 (1990)
   PUBMED   2338125
REFERENCE   8  (bases 1 to 617)
  AUTHORS   den Dunnen JT, van Neck JW, Cremers FP, Lubsen NH and Schoenmakers
            JG.
  TITLE     Nucleotide sequence of the rat gamma-crystallin gene region and
            comparison with an orthologous human region
  JOURNAL   Gene 78 (2), 201-213 (1989)
   PUBMED   2777080
REFERENCE   9  (bases 1 to 617)
  AUTHORS   den Dunnen,J.T., Moormann,R.J., Lubsen,N.H. and Schoenmakers,J.G.
  TITLE     Concerted and divergent evolution within the rat gamma-crystallin
            gene family
  JOURNAL   J Mol Biol 189 (1), 37-46 (1986)
   PUBMED   3783678
REFERENCE   10 (bases 1 to 617)
  AUTHORS   Moormann,R.J., den Dunnen,J.T., Bloemendal,H. and Schoenmakers,J.G.
  TITLE     Extensive intragenic sequence homology in two distinct rat lens
            gamma-crystallin cDNAs suggests duplications of a primordial gene
  JOURNAL   Proc Natl Acad Sci U S A 79 (22), 6876-6880 (1982)
   PUBMED   6294661
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BF523642.1, BG371711.1 and AI717452.1.
            
            On or before Oct 11, 2007 this sequence version replaced
            XM_343582.3, XM_001072287.1.
            
            Transcript Variant: This variant (1) encodes the longer protein
            (isoform 1).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-84                BF523642.1         7-90
            85-250              BG371711.1         374-539             c
            251-617             AI717452.1         1-367               c
FEATURES             Location/Qualifiers
     source          1..617
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="9"
                     /map="9q32"
     gene            1..617
                     /gene="Crygc"
                     /gene_synonym="Cryg; Cryg3; Len"
                     /note="crystallin, gamma C"
                     /db_xref="GeneID:24277"
                     /db_xref="RGD:2421"
     exon            1..16
                     /gene="Crygc"
                     /gene_synonym="Cryg; Cryg3; Len"
                     /inference="alignment:Splign:2.1.0"
     CDS             8..535
                     /gene="Crygc"
                     /gene_synonym="Cryg; Cryg3; Len"
                     /note="isoform 1 is encoded by transcript variant 1;
                     gamma-crystallin C; gamma-C-crystallin; gamma-crystallin
                     2-1; crystallin, gamma polypeptide 3"
                     /codon_start=1
                     /product="gamma-crystallin C isoform 1"
                     /protein_id="NP_264077.1"
                     /db_xref="GeneID:24277"
                     /db_xref="RGD:2421"
                     /translation="

MGKITFYEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPHQTGSHRMRLYEKEDHKGVMMELSEDCSCIQDRFHLSEVRSLHVLEGCWVLYEMSNYRGRQYLLRPQEYRRYHDWGAVDAKAGSLRRVVDLY"

     misc_feature    14..253
                     /gene="Crygc"
                     /gene_synonym="Cryg; Cryg3; Len"
                     /note="Beta/gamma crystallins; Region: XTALbg; smart00247"
                     /db_xref="CDD:214583"
     misc_feature    74..76
                     /gene="Crygc"
                     /gene_synonym="Cryg; Cryg3; Len"
                     /note="S-methylcysteine. /evidence=ECO:0000250; propagated
                     from UniProtKB/Swiss-Prot (P02529.4); methylation site"
     misc_feature    275..520
                     /gene="Crygc"
                     /gene_synonym="Cryg; Cryg3; Len"
                     /note="Beta/Gamma crystallin; Region: Crystall; pfam00030"
                     /db_xref="CDD:425430"
     exon            17..259
                     /gene="Crygc"
                     /gene_synonym="Cryg; Cryg3; Len"
                     /inference="alignment:Splign:2.1.0"
     exon            260..603
                     /gene="Crygc"
                     /gene_synonym="Cryg; Cryg3; Len"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gccagccatggggaagatcaccttctacgaggaccgaggcttccagggccgctgctatgagtgcagcagcgactgccccaacctgcagacctacttcagccgctgcaactccgtccgcgtggacagtggctgctggatgctctatgagcgacccaactaccagggccaccagtacttcctgcgacgcggggactaccctgactaccagcagtggatgggtttcagcgactccattcgctcctgccgcctcatcccccatcagacaggttcccacaggatgcgtctgtatgagaaagaagatcacaaaggcgtcatgatggagctgagtgaagactgctcctgcatccaggaccgcttccacctcagtgaggtgcgctcgctgcacgtgctagagggctgctgggtcctctatgagatgtctaactaccgaggccggcagtatctgctgaggcctcaagagtaccggcgctaccacgactggggcgctgtagatgctaaggcaggctctttgcggagggtggtagatttatactaaaataggtgaacgctaccattttctcattttggaacctaataaagtatttagtctgtattgttggcaaaaaaaaaaaaaaaaa

//