LOCUS       NM_031565               2046 bp    mRNA    linear   ROD 29-JUN-2023
DEFINITION  Rattus norvegicus carboxylesterase 1E (Ces1e), mRNA.
ACCESSION   NM_031565 XM_343651
VERSION     NM_031565.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2046)
  AUTHORS   Holmes RS, Wright MW, Laulederkind SJ, Cox LA, Hosokawa M, Imai T,
            Ishibashi S, Lehner R, Miyazaki M, Perkins EJ, Potter PM, Redinbo
            MR, Robert J, Satoh T, Yamashita T, Yan B, Yokoi T, Zechner R and
            Maltais LJ.
  TITLE     Recommended nomenclature for five mammalian carboxylesterase gene
            families: human, mouse, and rat genes and proteins
  JOURNAL   Mamm Genome 21 (9-10), 427-441 (2010)
   PUBMED   20931200
REFERENCE   2  (bases 1 to 2046)
  AUTHORS   Takahashi S, Katoh M, Saitoh T, Nakajima M and Yokoi T.
  TITLE     Different inhibitory effects in rat and human carboxylesterases
  JOURNAL   Drug Metab Dispos 37 (5), 956-961 (2009)
   PUBMED   19225040
REFERENCE   3  (bases 1 to 2046)
  AUTHORS   Holmes RS, Glenn JP, VandeBerg JL and Cox LA.
  TITLE     Baboon carboxylesterases 1 and 2: sequences, structures and
            phylogenetic relationships with human and other primate
            carboxylesterases
  JOURNAL   J Med Primatol 38 (1), 27-38 (2009)
   PUBMED   19187434
REFERENCE   4  (bases 1 to 2046)
  AUTHORS   Taketani M, Shii M, Ohura K, Ninomiya S and Imai T.
  TITLE     Carboxylesterase in the liver and small intestine of experimental
            animals and human
  JOURNAL   Life Sci 81 (11), 924-932 (2007)
   PUBMED   17764701
  REMARK    GeneRIF: comparative analysis of CES1 and CES2 in liver and small
            intestine of humans, monkeys, dogs, rabbits and rats
REFERENCE   5  (bases 1 to 2046)
  AUTHORS   Langston TB, Hylemon PB and Grogan WM.
  TITLE     Over-expression of hepatic neutral cytosolic cholesteryl ester
            hydrolase in mice increases free cholesterol and reduces expression
            of HMG-CoAR, CYP27, and CYP7A1
  JOURNAL   Lipids 40 (1), 31-38 (2005)
   PUBMED   15825828
  REMARK    GeneRIF: results demonstrate elevation of FC and depletion of
            cholesteryl esters by over-expression of hncCEH, which were
            resistant to compensatory responses by other enzymes of cholesterol
            homeostasis
REFERENCE   6  (bases 1 to 2046)
  AUTHORS   Ghosh S, Mallonee DH, Hylemon PB and Grogan WM.
  TITLE     Molecular cloning and expression of rat hepatic neutral cholesteryl
            ester hydrolase
  JOURNAL   Biochim Biophys Acta 1259 (3), 305-312 (1995)
   PUBMED   8541339
REFERENCE   7  (bases 1 to 2046)
  AUTHORS   Yan B, Yang D, Brady M and Parkinson A.
  TITLE     Rat kidney carboxylesterase. Cloning, sequencing, cellular
            localization, and relationship to rat liver hydrolase
  JOURNAL   J Biol Chem 269 (47), 29688-29696 (1994)
   PUBMED   7961958
REFERENCE   8  (bases 1 to 2046)
  AUTHORS   Robbi M and Beaufay H.
  TITLE     Cloning and sequencing of rat liver carboxylesterase ES-3 (egasyn)
  JOURNAL   Biochem Biophys Res Commun 203 (3), 1404-1411 (1994)
   PUBMED   7945287
REFERENCE   9  (bases 1 to 2046)
  AUTHORS   Medda S and Proia RL.
  TITLE     The carboxylesterase family exhibits C-terminal sequence diversity
            reflecting the presence or absence of
            endoplasmic-reticulum-retention sequences
  JOURNAL   Eur J Biochem 206 (3), 801-806 (1992)
   PUBMED   1606962
REFERENCE   10 (bases 1 to 2046)
  AUTHORS   Robbi M, Beaufay H and Octave JN.
  TITLE     Nucleotide sequence of cDNA coding for rat liver pI 6.1 esterase
            (ES-10), a carboxylesterase located in the lumen of the endoplasmic
            reticulum
  JOURNAL   Biochem J 269 (2), 451-458 (1990)
   PUBMED   2386485
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000305.1.
            
            On Jun 29, 2023 this sequence version replaced NM_031565.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: X81395.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMEA5760400
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-243               JACYVU010000305.1  67965-68207
            244-448             JACYVU010000305.1  72206-72410
            449-593             JACYVU010000305.1  74578-74722
            594-727             JACYVU010000305.1  77733-77866
            728-881             JACYVU010000305.1  79500-79653
            882-986             JACYVU010000305.1  82598-82702
            987-1091            JACYVU010000305.1  83421-83525
            1092-1130           JACYVU010000305.1  85530-85568
            1131-1271           JACYVU010000305.1  87391-87531
            1272-1352           JACYVU010000305.1  88915-88995
            1353-1500           JACYVU010000305.1  89232-89379
            1501-1632           JACYVU010000305.1  102652-102783
            1633-1705           JACYVU010000305.1  103637-103709
            1706-2046           JACYVU010000305.1  104082-104422
FEATURES             Location/Qualifiers
     source          1..2046
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="19"
                     /map="19p11"
     gene            1..2046
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /note="carboxylesterase 1E"
                     /db_xref="GeneID:29225"
                     /db_xref="RGD:621508"
     exon            1..243
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    180..182
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /note="upstream in-frame stop codon"
     CDS             192..1877
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /EC_number="3.1.1.1"
                     /note="liver carboxylesterase 3; ES-HTEL; pI 5.5 esterase;
                     carboxyesterase ES-3; esterase 22; carboxylesterase 1;
                     egasyn"
                     /codon_start=1
                     /product="carboxylesterase 1E precursor"
                     /protein_id="NP_113753.2"
                     /db_xref="GeneID:29225"
                     /db_xref="RGD:621508"
                     /translation="

MCLYALILVFLAAFTAGGHPSSLPVVDTLQGKVLGKYVSLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDPVAGQIVNDLLTNREENISLQFSEDCLYLNIYTPADLTKRDRLPVMVWIHGGGLVLGGASTYDGLALSTHENVVVVVIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIDNFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFHKAISESGVALTAGLVKKNTRPLAEKIAVVSGCKSTTSAAMVHCLRQKTEEELLETTLKLNLFSLDLHGDSRQSYPFVPTVLDGVVLPKMPEEILAEKDFNTVPYIVGINKQEFGWILPTMMNYPPSDMKLDPMTATSLLKKSSFLLNLPEEAIPVAVEKYLRHTDDPDRNKDQLLELIGDVIFGVPSVIVSRGHRDAGARTYMYEFQYRPSFSSKMKPSTVVGDHGDEIYSVFGAPILRGGTSKEEINLSKMMMKFWANFARNGNPNGQGLPHWPEYDQKEGYLQIGATTQQAQKLKEKEVAFWSELLAMKPLHAGHTEL"

     sig_peptide     192..245
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /note="/evidence=ECO:0000250; propagated from
                     UniProtKB/Swiss-Prot (Q63108.1)"
     mat_peptide     246..1874
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /product="Carboxylesterase 1E. /id=PRO_0000008580"
                     /note="propagated from UniProtKB/Swiss-Prot (Q63108.1)"
     misc_feature    261..1826
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /note="Carboxylesterase family; Region: COesterase;
                     pfam00135"
                     /db_xref="CDD:395084"
     misc_feature    426..428
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q63108.1); glycosylation site"
     misc_feature    510..512
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q63108.1); glycosylation site"
     misc_feature    order(612..620,849..857,864..866,1335..1337,1347..1352,
                     1446..1448,1590..1592,1599..1601)
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238191"
     misc_feature    order(852..854,1248..1250,1587..1589)
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238191"
     misc_feature    1656..1658
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q63108.1); glycosylation site"
     misc_feature    1863..1874
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /note="propagated from UniProtKB/Swiss-Prot (Q63108.1);
                     Region: Prevents secretion from ER. /evidence=ECO:0000255"
     exon            244..448
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     exon            449..593
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     exon            594..727
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     exon            728..881
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     exon            882..986
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     exon            987..1091
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     exon            1092..1130
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     exon            1131..1271
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     exon            1272..1352
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     exon            1353..1500
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     exon            1501..1632
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     exon            1633..1705
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
     exon            1706..2046
                     /gene="Ces1e"
                     /gene_synonym="Ces1; Es22"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

tggcttagtgaactcctgaaaagccccgtaggactctttggaatagaaggattgttcttttctggtagcatacaatcgattgagaggaatttgctagtaatctccaggagtgcggcaggatccaggatccgtgtggtccccttgtcataggctggagatctcgctgtcccccaagcctgtagccttctatcatgtgcctctatgctctgatcctggtgtttcttgcagcattcacagcagggggacacccatcgtcactacccgtagtggacaccctgcaaggcaaagtcctcgggaagtacgtcagcttagaaggattcacacagcctgtggccgtcttcctgggagtcccctttgccaagccccctctcggatctctgaggtttgctccaccacagcctgcagagccctggagcttcgtaaagaacaccacctcctaccctcctatgtgctcccaagaccccgtggcagggcaaatagtcaatgaccttctaactaaccgggaagagaacatttctctccagttttctgaagactgtctctacctaaatatttacacgcctgctgacttgacaaaacgtgatagactgccggtgatggtgtggatccatggaggtggactagtgttaggtggggcatccacctatgatggactagccctgtctactcatgaaaatgtggtggtagtggtcattcaataccgtctgggtatttggggattcttcagcacaggggatgaacacagccggggcaactggggtcacttggaccaggtggctgcactgcactgggtccaggacaacattgacaactttggaggggacccaggctctgtgaccatctttggagagtcagcaggaggtgaaagtgtctctgttcttgtgttgtctcccttggccaagaatctctttcacaaggccatttccgaaagtggcgtggccctcactgcaggcctggtcaagaagaacaccaggcccttggctgagaaaattgctgttgtatctggttgtaaaagcacaacttcagctgccatggttcactgccttcgccagaagacagaggaagagctcttggagaccacactaaaattgaatcttttttcgctggatttgcacggagactccaggcagagctatccgtttgttcccactgtgcttgatggagtggtgctgccaaagatgcctgaggagatcctggctgagaaggacttcaacactgtgccctacatcgtgggaatcaacaagcaagagtttggctggattctgccaacaatgatgaactatccaccctctgatatgaaattggacccgatgacagccacatcgctcttgaagaagtcttcttttcttcttaaccttcctgaagaagcaattccagtggccgttgagaagtatttaagacacacagatgacccagacagaaataaagaccaacttctggaattgattggggatgtgatcttcggtgtcccatcagtgattgtctcccgtggacatagagatgctggagcccgcacatacatgtacgagtttcaatatcgcccaagcttctcatcaaaaatgaaaccaagtacggtggtaggagatcatggagacgaaatctactctgtctttggtgctccaattttaagaggtggtacctcaaaagaggagatcaatctcagcaagatgatgatgaaattctgggcaaactttgctaggaatgggaatcccaatggacagggcctgccccattggccagagtatgaccaaaaggaaggttatcttcagattggagccaccactcaacaagcccagaagctaaaagaaaaagaagtggctttctggtctgagcttctggctatgaagccactgcatgcaggacacactgagctatgaacgggaggctctgccagcctcatcctcagggcagctcacatggaagatggttttggccaaggctttgaggagacttcagaactgtgtggtgggagtgggcagaggccagggagaggatatttgcacatgtggactcaaactgaaaaataaattttgttttataaatcaa

//