2024-05-01 08:47:11, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_031565 2046 bp mRNA linear ROD 29-JUN-2023 DEFINITION Rattus norvegicus carboxylesterase 1E (Ces1e), mRNA. ACCESSION NM_031565 XM_343651 VERSION NM_031565.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 2046) AUTHORS Holmes RS, Wright MW, Laulederkind SJ, Cox LA, Hosokawa M, Imai T, Ishibashi S, Lehner R, Miyazaki M, Perkins EJ, Potter PM, Redinbo MR, Robert J, Satoh T, Yamashita T, Yan B, Yokoi T, Zechner R and Maltais LJ. TITLE Recommended nomenclature for five mammalian carboxylesterase gene families: human, mouse, and rat genes and proteins JOURNAL Mamm Genome 21 (9-10), 427-441 (2010) PUBMED 20931200 REFERENCE 2 (bases 1 to 2046) AUTHORS Takahashi S, Katoh M, Saitoh T, Nakajima M and Yokoi T. TITLE Different inhibitory effects in rat and human carboxylesterases JOURNAL Drug Metab Dispos 37 (5), 956-961 (2009) PUBMED 19225040 REFERENCE 3 (bases 1 to 2046) AUTHORS Holmes RS, Glenn JP, VandeBerg JL and Cox LA. TITLE Baboon carboxylesterases 1 and 2: sequences, structures and phylogenetic relationships with human and other primate carboxylesterases JOURNAL J Med Primatol 38 (1), 27-38 (2009) PUBMED 19187434 REFERENCE 4 (bases 1 to 2046) AUTHORS Taketani M, Shii M, Ohura K, Ninomiya S and Imai T. TITLE Carboxylesterase in the liver and small intestine of experimental animals and human JOURNAL Life Sci 81 (11), 924-932 (2007) PUBMED 17764701 REMARK GeneRIF: comparative analysis of CES1 and CES2 in liver and small intestine of humans, monkeys, dogs, rabbits and rats REFERENCE 5 (bases 1 to 2046) AUTHORS Langston TB, Hylemon PB and Grogan WM. TITLE Over-expression of hepatic neutral cytosolic cholesteryl ester hydrolase in mice increases free cholesterol and reduces expression of HMG-CoAR, CYP27, and CYP7A1 JOURNAL Lipids 40 (1), 31-38 (2005) PUBMED 15825828 REMARK GeneRIF: results demonstrate elevation of FC and depletion of cholesteryl esters by over-expression of hncCEH, which were resistant to compensatory responses by other enzymes of cholesterol homeostasis REFERENCE 6 (bases 1 to 2046) AUTHORS Ghosh S, Mallonee DH, Hylemon PB and Grogan WM. TITLE Molecular cloning and expression of rat hepatic neutral cholesteryl ester hydrolase JOURNAL Biochim Biophys Acta 1259 (3), 305-312 (1995) PUBMED 8541339 REFERENCE 7 (bases 1 to 2046) AUTHORS Yan B, Yang D, Brady M and Parkinson A. TITLE Rat kidney carboxylesterase. Cloning, sequencing, cellular localization, and relationship to rat liver hydrolase JOURNAL J Biol Chem 269 (47), 29688-29696 (1994) PUBMED 7961958 REFERENCE 8 (bases 1 to 2046) AUTHORS Robbi M and Beaufay H. TITLE Cloning and sequencing of rat liver carboxylesterase ES-3 (egasyn) JOURNAL Biochem Biophys Res Commun 203 (3), 1404-1411 (1994) PUBMED 7945287 REFERENCE 9 (bases 1 to 2046) AUTHORS Medda S and Proia RL. TITLE The carboxylesterase family exhibits C-terminal sequence diversity reflecting the presence or absence of endoplasmic-reticulum-retention sequences JOURNAL Eur J Biochem 206 (3), 801-806 (1992) PUBMED 1606962 REFERENCE 10 (bases 1 to 2046) AUTHORS Robbi M, Beaufay H and Octave JN. TITLE Nucleotide sequence of cDNA coding for rat liver pI 6.1 esterase (ES-10), a carboxylesterase located in the lumen of the endoplasmic reticulum JOURNAL Biochem J 269 (2), 451-458 (1990) PUBMED 2386485 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000305.1. On Jun 29, 2023 this sequence version replaced NM_031565.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: X81395.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5756307, SAMEA5760400 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-243 JACYVU010000305.1 67965-68207 244-448 JACYVU010000305.1 72206-72410 449-593 JACYVU010000305.1 74578-74722 594-727 JACYVU010000305.1 77733-77866 728-881 JACYVU010000305.1 79500-79653 882-986 JACYVU010000305.1 82598-82702 987-1091 JACYVU010000305.1 83421-83525 1092-1130 JACYVU010000305.1 85530-85568 1131-1271 JACYVU010000305.1 87391-87531 1272-1352 JACYVU010000305.1 88915-88995 1353-1500 JACYVU010000305.1 89232-89379 1501-1632 JACYVU010000305.1 102652-102783 1633-1705 JACYVU010000305.1 103637-103709 1706-2046 JACYVU010000305.1 104082-104422 FEATURES Location/Qualifiers source 1..2046 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="19" /map="19p11" gene 1..2046 /gene="Ces1e" /gene_synonym="Ces1; Es22" /note="carboxylesterase 1E" /db_xref="GeneID:29225" /db_xref="RGD:621508" exon 1..243 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" misc_feature 180..182 /gene="Ces1e" /gene_synonym="Ces1; Es22" /note="upstream in-frame stop codon" CDS 192..1877 /gene="Ces1e" /gene_synonym="Ces1; Es22" /EC_number="3.1.1.1" /note="liver carboxylesterase 3; ES-HTEL; pI 5.5 esterase; carboxyesterase ES-3; esterase 22; carboxylesterase 1; egasyn" /codon_start=1 /product="carboxylesterase 1E precursor" /protein_id="NP_113753.2" /db_xref="GeneID:29225" /db_xref="RGD:621508" /translation="
MCLYALILVFLAAFTAGGHPSSLPVVDTLQGKVLGKYVSLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDPVAGQIVNDLLTNREENISLQFSEDCLYLNIYTPADLTKRDRLPVMVWIHGGGLVLGGASTYDGLALSTHENVVVVVIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIDNFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLFHKAISESGVALTAGLVKKNTRPLAEKIAVVSGCKSTTSAAMVHCLRQKTEEELLETTLKLNLFSLDLHGDSRQSYPFVPTVLDGVVLPKMPEEILAEKDFNTVPYIVGINKQEFGWILPTMMNYPPSDMKLDPMTATSLLKKSSFLLNLPEEAIPVAVEKYLRHTDDPDRNKDQLLELIGDVIFGVPSVIVSRGHRDAGARTYMYEFQYRPSFSSKMKPSTVVGDHGDEIYSVFGAPILRGGTSKEEINLSKMMMKFWANFARNGNPNGQGLPHWPEYDQKEGYLQIGATTQQAQKLKEKEVAFWSELLAMKPLHAGHTEL"
sig_peptide 192..245 /gene="Ces1e" /gene_synonym="Ces1; Es22" /note="/evidence=ECO:0000250; propagated from UniProtKB/Swiss-Prot (Q63108.1)" mat_peptide 246..1874 /gene="Ces1e" /gene_synonym="Ces1; Es22" /product="Carboxylesterase 1E. /id=PRO_0000008580" /note="propagated from UniProtKB/Swiss-Prot (Q63108.1)" misc_feature 261..1826 /gene="Ces1e" /gene_synonym="Ces1; Es22" /note="Carboxylesterase family; Region: COesterase; pfam00135" /db_xref="CDD:395084" misc_feature 426..428 /gene="Ces1e" /gene_synonym="Ces1; Es22" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q63108.1); glycosylation site" misc_feature 510..512 /gene="Ces1e" /gene_synonym="Ces1; Es22" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q63108.1); glycosylation site" misc_feature order(612..620,849..857,864..866,1335..1337,1347..1352, 1446..1448,1590..1592,1599..1601) /gene="Ces1e" /gene_synonym="Ces1; Es22" /note="substrate binding pocket [chemical binding]; other site" /db_xref="CDD:238191" misc_feature order(852..854,1248..1250,1587..1589) /gene="Ces1e" /gene_synonym="Ces1; Es22" /note="catalytic triad [active]" /db_xref="CDD:238191" misc_feature 1656..1658 /gene="Ces1e" /gene_synonym="Ces1; Es22" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q63108.1); glycosylation site" misc_feature 1863..1874 /gene="Ces1e" /gene_synonym="Ces1; Es22" /note="propagated from UniProtKB/Swiss-Prot (Q63108.1); Region: Prevents secretion from ER. /evidence=ECO:0000255" exon 244..448 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" exon 449..593 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" exon 594..727 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" exon 728..881 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" exon 882..986 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" exon 987..1091 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" exon 1092..1130 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" exon 1131..1271 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" exon 1272..1352 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" exon 1353..1500 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" exon 1501..1632 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" exon 1633..1705 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" exon 1706..2046 /gene="Ces1e" /gene_synonym="Ces1; Es22" /inference="alignment:Splign:2.1.0" ORIGIN
tggcttagtgaactcctgaaaagccccgtaggactctttggaatagaaggattgttcttttctggtagcatacaatcgattgagaggaatttgctagtaatctccaggagtgcggcaggatccaggatccgtgtggtccccttgtcataggctggagatctcgctgtcccccaagcctgtagccttctatcatgtgcctctatgctctgatcctggtgtttcttgcagcattcacagcagggggacacccatcgtcactacccgtagtggacaccctgcaaggcaaagtcctcgggaagtacgtcagcttagaaggattcacacagcctgtggccgtcttcctgggagtcccctttgccaagccccctctcggatctctgaggtttgctccaccacagcctgcagagccctggagcttcgtaaagaacaccacctcctaccctcctatgtgctcccaagaccccgtggcagggcaaatagtcaatgaccttctaactaaccgggaagagaacatttctctccagttttctgaagactgtctctacctaaatatttacacgcctgctgacttgacaaaacgtgatagactgccggtgatggtgtggatccatggaggtggactagtgttaggtggggcatccacctatgatggactagccctgtctactcatgaaaatgtggtggtagtggtcattcaataccgtctgggtatttggggattcttcagcacaggggatgaacacagccggggcaactggggtcacttggaccaggtggctgcactgcactgggtccaggacaacattgacaactttggaggggacccaggctctgtgaccatctttggagagtcagcaggaggtgaaagtgtctctgttcttgtgttgtctcccttggccaagaatctctttcacaaggccatttccgaaagtggcgtggccctcactgcaggcctggtcaagaagaacaccaggcccttggctgagaaaattgctgttgtatctggttgtaaaagcacaacttcagctgccatggttcactgccttcgccagaagacagaggaagagctcttggagaccacactaaaattgaatcttttttcgctggatttgcacggagactccaggcagagctatccgtttgttcccactgtgcttgatggagtggtgctgccaaagatgcctgaggagatcctggctgagaaggacttcaacactgtgccctacatcgtgggaatcaacaagcaagagtttggctggattctgccaacaatgatgaactatccaccctctgatatgaaattggacccgatgacagccacatcgctcttgaagaagtcttcttttcttcttaaccttcctgaagaagcaattccagtggccgttgagaagtatttaagacacacagatgacccagacagaaataaagaccaacttctggaattgattggggatgtgatcttcggtgtcccatcagtgattgtctcccgtggacatagagatgctggagcccgcacatacatgtacgagtttcaatatcgcccaagcttctcatcaaaaatgaaaccaagtacggtggtaggagatcatggagacgaaatctactctgtctttggtgctccaattttaagaggtggtacctcaaaagaggagatcaatctcagcaagatgatgatgaaattctgggcaaactttgctaggaatgggaatcccaatggacagggcctgccccattggccagagtatgaccaaaaggaaggttatcttcagattggagccaccactcaacaagcccagaagctaaaagaaaaagaagtggctttctggtctgagcttctggctatgaagccactgcatgcaggacacactgagctatgaacgggaggctctgccagcctcatcctcagggcagctcacatggaagatggttttggccaaggctttgaggagacttcagaactgtgtggtgggagtgggcagaggccagggagaggatatttgcacatgtggactcaaactgaaaaataaattttgttttataaatcaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]