LOCUS       NM_019323                850 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus mast cell protease 9 (Mcpt9), mRNA.
ACCESSION   NM_019323
VERSION     NM_019323.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 850)
  AUTHORS   Lutzelschwab C, Pejler G, Aveskogh M and Hellman L.
  TITLE     Secretory granule proteases in rat mast cells. Cloning of 10
            different serine proteases and a carboxypeptidase A from various
            rat mast cell populations
  JOURNAL   J Exp Med 185 (1), 13-29 (1997)
   PUBMED   8996238
REFERENCE   2  (bases 1 to 850)
  AUTHORS   Ewoldt GR, Darcy PK, Snook MB, Hudig D and Smyth MJ.
  TITLE     cDNA cloning of granzyme J
  JOURNAL   Immunogenetics 45 (6), 452-454 (1997)
   PUBMED   9089107
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000269.1.
            
            On Mar 5, 2021 this sequence version replaced NM_019323.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U72143.1, U67912.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760400, SAMEA5760434
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-76                JACYVU010000269.1  58912-58987
            77-227              JACYVU010000269.1  60159-60309
            228-360             JACYVU010000269.1  60620-60752
            361-615             JACYVU010000269.1  60975-61229
            616-850             JACYVU010000269.1  61641-61875
FEATURES             Location/Qualifiers
     source          1..850
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="15"
                     /map="15p12"
     gene            1..850
                     /gene="Mcpt9"
                     /note="mast cell protease 9"
                     /db_xref="GeneID:54272"
                     /db_xref="RGD:3068"
     exon            1..76
                     /gene="Mcpt9"
                     /inference="alignment:Splign:2.1.0"
     CDS             22..768
                     /gene="Mcpt9"
                     /note="granzyme J"
                     /codon_start=1
                     /product="mast cell protease 9 precursor"
                     /protein_id="NP_062196.2"
                     /db_xref="GeneID:54272"
                     /db_xref="RGD:3068"
                     /translation="

MFLFLFFLVAVLPVNTEGGEILWGTESKPHSRPYMAFINFYDSNSDLNRCGGFLVAKDIVMTAAHCNGRNIKVILGAHNIKKRENTQVISVLKAKPHENFNSDSLVNDIMLLKLERKAQLNGVVKTIALPRSQDWVKPGQVCTVAGWGTLANCTLSNTLQEVNLEVQKGQKCQGMSRNYNDSIQLCVGNPNERKATAGGDSGGPFVCNGVAQGIVSYRLCTWTPPRVFTRISSFIPWIQKTMKLLQQP"

     sig_peptide     22..75
                     /gene="Mcpt9"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    82..744
                     /gene="Mcpt9"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    82..84
                     /gene="Mcpt9"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(214..216,343..345,622..624)
                     /gene="Mcpt9"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(604..606,667..669,673..675)
                     /gene="Mcpt9"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
     exon            77..227
                     /gene="Mcpt9"
                     /inference="alignment:Splign:2.1.0"
     exon            228..360
                     /gene="Mcpt9"
                     /inference="alignment:Splign:2.1.0"
     exon            361..615
                     /gene="Mcpt9"
                     /inference="alignment:Splign:2.1.0"
     exon            616..850
                     /gene="Mcpt9"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cctggtcagaccctgaagaggatgttcctgttcctgttcttcctggtggccgtcctaccagtcaacactgaaggaggagagatcttatggggtacagagtccaaaccccactcccggccctacatggcattcataaatttttatgatagcaattcagacctcaatcgctgtggcggtttcctggtggcaaaagacattgtaatgacagcagctcactgtaatggaagaaatataaaagtaatcttaggtgctcacaatatcaagaaacgagaaaacacccaggtcatctctgttctaaaggccaaacctcacgagaactttaatagtgattcactggttaatgacatcatgctcctgaagttggaacgcaaagctcaactcaatggtgttgtgaagactattgcccttcctaggagccaggactgggtgaaacctgggcaggtgtgcacagtggcaggttgggggaccttggccaattgtactttgtctaacacacttcaagaagtgaatctagaagttcaaaaaggtcagaagtgccaaggcatgtccagaaactacaatgactccatccagctttgtgtgggaaaccccaatgagaggaaggctactgctgggggagactcagggggtccatttgtgtgcaatggagtggcccagggcattgtcagttatcgcttgtgtacttggacacctcctcgagtattcaccagaatctccagcttcataccgtggattcagaaaacaatgaaactccttcaacaaccctagaacacaaaacctgtgtctgggccaatgtccagcatcctggggtatggctatctgagtcttaataaagaaatctgtctgcagg

//