2024-05-06 21:40:04, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_019323 850 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus mast cell protease 9 (Mcpt9), mRNA. ACCESSION NM_019323 VERSION NM_019323.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 850) AUTHORS Lutzelschwab C, Pejler G, Aveskogh M and Hellman L. TITLE Secretory granule proteases in rat mast cells. Cloning of 10 different serine proteases and a carboxypeptidase A from various rat mast cell populations JOURNAL J Exp Med 185 (1), 13-29 (1997) PUBMED 8996238 REFERENCE 2 (bases 1 to 850) AUTHORS Ewoldt GR, Darcy PK, Snook MB, Hudig D and Smyth MJ. TITLE cDNA cloning of granzyme J JOURNAL Immunogenetics 45 (6), 452-454 (1997) PUBMED 9089107 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000269.1. On Mar 5, 2021 this sequence version replaced NM_019323.1. ##Evidence-Data-START## Transcript exon combination :: U72143.1, U67912.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760400, SAMEA5760434 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-76 JACYVU010000269.1 58912-58987 77-227 JACYVU010000269.1 60159-60309 228-360 JACYVU010000269.1 60620-60752 361-615 JACYVU010000269.1 60975-61229 616-850 JACYVU010000269.1 61641-61875 FEATURES Location/Qualifiers source 1..850 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="15" /map="15p12" gene 1..850 /gene="Mcpt9" /note="mast cell protease 9" /db_xref="GeneID:54272" /db_xref="RGD:3068" exon 1..76 /gene="Mcpt9" /inference="alignment:Splign:2.1.0" CDS 22..768 /gene="Mcpt9" /note="granzyme J" /codon_start=1 /product="mast cell protease 9 precursor" /protein_id="NP_062196.2" /db_xref="GeneID:54272" /db_xref="RGD:3068" /translation="
MFLFLFFLVAVLPVNTEGGEILWGTESKPHSRPYMAFINFYDSNSDLNRCGGFLVAKDIVMTAAHCNGRNIKVILGAHNIKKRENTQVISVLKAKPHENFNSDSLVNDIMLLKLERKAQLNGVVKTIALPRSQDWVKPGQVCTVAGWGTLANCTLSNTLQEVNLEVQKGQKCQGMSRNYNDSIQLCVGNPNERKATAGGDSGGPFVCNGVAQGIVSYRLCTWTPPRVFTRISSFIPWIQKTMKLLQQP"
sig_peptide 22..75 /gene="Mcpt9" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 82..744 /gene="Mcpt9" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cd00190" /db_xref="CDD:238113" misc_feature 82..84 /gene="Mcpt9" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(214..216,343..345,622..624) /gene="Mcpt9" /note="active site" /db_xref="CDD:238113" misc_feature order(604..606,667..669,673..675) /gene="Mcpt9" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" exon 77..227 /gene="Mcpt9" /inference="alignment:Splign:2.1.0" exon 228..360 /gene="Mcpt9" /inference="alignment:Splign:2.1.0" exon 361..615 /gene="Mcpt9" /inference="alignment:Splign:2.1.0" exon 616..850 /gene="Mcpt9" /inference="alignment:Splign:2.1.0" ORIGIN
cctggtcagaccctgaagaggatgttcctgttcctgttcttcctggtggccgtcctaccagtcaacactgaaggaggagagatcttatggggtacagagtccaaaccccactcccggccctacatggcattcataaatttttatgatagcaattcagacctcaatcgctgtggcggtttcctggtggcaaaagacattgtaatgacagcagctcactgtaatggaagaaatataaaagtaatcttaggtgctcacaatatcaagaaacgagaaaacacccaggtcatctctgttctaaaggccaaacctcacgagaactttaatagtgattcactggttaatgacatcatgctcctgaagttggaacgcaaagctcaactcaatggtgttgtgaagactattgcccttcctaggagccaggactgggtgaaacctgggcaggtgtgcacagtggcaggttgggggaccttggccaattgtactttgtctaacacacttcaagaagtgaatctagaagttcaaaaaggtcagaagtgccaaggcatgtccagaaactacaatgactccatccagctttgtgtgggaaaccccaatgagaggaaggctactgctgggggagactcagggggtccatttgtgtgcaatggagtggcccagggcattgtcagttatcgcttgtgtacttggacacctcctcgagtattcaccagaatctccagcttcataccgtggattcagaaaacaatgaaactccttcaacaaccctagaacacaaaacctgtgtctgggccaatgtccagcatcctggggtatggctatctgagtcttaataaagaaatctgtctgcagg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]