LOCUS       NM_017244                772 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus cellular retinoic acid binding protein 2
            (Crabp2), mRNA.
ACCESSION   NM_017244 XM_001073561
VERSION     NM_017244.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 772)
  AUTHORS   Zhang W, Vreeland AC and Noy N.
  TITLE     RNA-binding protein HuR regulates nuclear import of protein
  JOURNAL   J Cell Sci 129 (21), 4025-4033 (2016)
   PUBMED   27609837
REFERENCE   2  (bases 1 to 772)
  AUTHORS   Napoli JL.
  TITLE     Physiological insights into all-trans-retinoic acid biosynthesis
  JOURNAL   Biochim Biophys Acta 1821 (1), 152-167 (2012)
   PUBMED   21621639
  REMARK    Review article
REFERENCE   3  (bases 1 to 772)
  AUTHORS   Gonzales PA, Pisitkun T, Hoffert JD, Tchapyjnikov D, Star RA, Kleta
            R, Wang NS and Knepper MA.
  TITLE     Large-scale proteomics and phosphoproteomics of urinary exosomes
  JOURNAL   J Am Soc Nephrol 20 (2), 363-379 (2009)
   PUBMED   19056867
REFERENCE   4  (bases 1 to 772)
  AUTHORS   Dieplinger B, Schiefermeier N, Juchum-Pasquazzo M, Gstir R, Huber
            LA, Klimaschewski L and Vietor I.
  TITLE     The transcriptional corepressor TPA-inducible sequence 7 regulates
            adult axon growth through cellular retinoic acid binding protein II
            expression
  JOURNAL   Eur J Neurosci 26 (12), 3358-3367 (2007)
   PUBMED   18052984
REFERENCE   5  (bases 1 to 772)
  AUTHORS   Flajollet S, Lefebvre B, Rachez C and Lefebvre P.
  TITLE     Distinct roles of the steroid receptor coactivator 1 and of MED1 in
            retinoid-induced transcription and cellular differentiation
  JOURNAL   J Biol Chem 281 (29), 20338-20348 (2006)
   PUBMED   16723356
REFERENCE   6  (bases 1 to 772)
  AUTHORS   Despouy G, Bastie JN, Deshaies S, Balitrand N, Mazharian A,
            Rochette-Egly C, Chomienne C and Delva L.
  TITLE     Cyclin D3 is a cofactor of retinoic acid receptors, modulating
            their activity in the presence of cellular retinoic acid-binding
            protein II
  JOURNAL   J Biol Chem 278 (8), 6355-6362 (2003)
   PUBMED   12482873
REFERENCE   7  (bases 1 to 772)
  AUTHORS   Yamamoto M, Drager UC, Ong DE and McCaffery P.
  TITLE     Retinoid-binding proteins in the cerebellum and choroid plexus and
            their relationship to regionalized retinoic acid synthesis and
            degradation
  JOURNAL   Eur J Biochem 257 (2), 344-350 (1998)
   PUBMED   9826179
REFERENCE   8  (bases 1 to 772)
  AUTHORS   Bucco RA, Melner MH, Gordon DS, Leers-Sucheta S and Ong DE.
  TITLE     Inducible expression of cellular retinoic acid-binding protein II
            in rat ovary: gonadotropin regulation during luteal development
  JOURNAL   Endocrinology 136 (6), 2730-2740 (1995)
   PUBMED   7750498
REFERENCE   9  (bases 1 to 772)
  AUTHORS   Fawcett D, Pasceri P, Fraser R, Colbert M, Rossant J and Giguere V.
  TITLE     Postaxial polydactyly in forelimbs of CRABP-II mutant mice
  JOURNAL   Development 121 (3), 671-679 (1995)
   PUBMED   7720575
REFERENCE   10 (bases 1 to 772)
  AUTHORS   Chapman JM and Curley RW Jr.
  TITLE     Affinity purification of retinoic acid-binding proteins using
            immobilized 4-(2-hydroxyethoxy)retinoic acid
  JOURNAL   Protein Expr Purif 1 (1), 63-69 (1990)
   PUBMED   1967079
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JACYVU010000069.1.
            
            On Nov 27, 2020 this sequence version replaced NM_017244.1.
            
            Sequence Note: This sequence has been modified as follows: removed
            28 bp suspected to be vector contamination from the 3' end.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U23407.1, CO403862.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760384, SAMEA5760386
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-172               JACYVU010000069.1  39889424-39889595
            173-354             JACYVU010000069.1  39892640-39892821
            355-471             JACYVU010000069.1  39893011-39893127
            472-772             JACYVU010000069.1  39893472-39893772
FEATURES             Location/Qualifiers
     source          1..772
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="2"
                     /map="2q34"
     gene            1..772
                     /gene="Crabp2"
                     /note="cellular retinoic acid binding protein 2"
                     /db_xref="GeneID:29563"
                     /db_xref="RGD:62070"
     exon            1..172
                     /gene="Crabp2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    76..78
                     /gene="Crabp2"
                     /note="upstream in-frame stop codon"
     CDS             103..522
                     /gene="Crabp2"
                     /note="cellular lipid-binding protein; cellular retinoic
                     acid-binding protein II; CRABP-II; cellular retinoic
                     acid-binding protein 2-like"
                     /codon_start=1
                     /product="cellular retinoic acid-binding protein 2"
                     /protein_id="NP_058940.1"
                     /db_xref="GeneID:29563"
                     /db_xref="RGD:62070"
                     /translation="

MPNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDDTFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESENKMVCEQRLLKGEGPKTSWSRELTNDGELILTMTADDVVCTRVYVRE"

     misc_feature    109..519
                     /gene="Crabp2"
                     /note="lipocalin/cytosolic fatty acid-binding protein
                     family; Region: lipocalin_FABP; cl10502"
                     /db_xref="CDD:447910"
     misc_feature    order(112..114,124..126,226..228,232..234,256..258,
                     262..264,268..270,289..291,295..297,301..303,391..393,
                     397..399,427..429,433..435,439..441,463..465,469..471,
                     475..477,496..498,502..504,508..510)
                     /gene="Crabp2"
                     /note="ligand binding cavity [chemical binding]; other
                     site"
                     /db_xref="CDD:381182"
     misc_feature    163..195
                     /gene="Crabp2"
                     /note="propagated from UniProtKB/Swiss-Prot (P51673.2);
                     Region: Nuclear localization signal.
                     /evidence=ECO:0000250"
     exon            173..354
                     /gene="Crabp2"
                     /inference="alignment:Splign:2.1.0"
     exon            355..471
                     /gene="Crabp2"
                     /inference="alignment:Splign:2.1.0"
     exon            472..772
                     /gene="Crabp2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gatctgttctgcaaaggggacagcaaggtacctttaggctaaaggactcggcgtccagtattctagttgaagatctaaagagaaagccaccttgctgccactatgcctaacttttctggcaactggaagatcatccgatcggaaaactttgaagaaatgctaaaagctctgggggtgaacatgatgatgaggaagattgctgtggctgcagcctccaagccagcagtggagatcaaacaggagaatgatgacactttctacatcaaaacctccaccactgttcgaaccacggagattaacttcaagatcggggaggaatttgaggagcagactgtggatgggagaccctgtaagagtttggtgaaatgggagagtgaaaacaaaatggtgtgcgaacagaggcttctgaagggggagggccccaaaacctcctggagccgagaactgaccaatgatggagagctaatcctgaccatgacagcagacgacgttgtatgcaccagggtctacgtccgagagtgagtgcctatgtccaagaacttcttctggaggccacaaacctccctcccatgtccattttacaaactagctctccccttactcctgagggtcactctctatgccagagaggggcagactaccaaagctcagaacccttccatttgcctggtcagaagtcccagctccataccaggatccttcctggaagagactgtctctctggcctctactctttatccttgtagtccaagtgatttagaatatttattgg

//