2024-05-06 05:33:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_017244 772 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus cellular retinoic acid binding protein 2 (Crabp2), mRNA. ACCESSION NM_017244 XM_001073561 VERSION NM_017244.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 772) AUTHORS Zhang W, Vreeland AC and Noy N. TITLE RNA-binding protein HuR regulates nuclear import of protein JOURNAL J Cell Sci 129 (21), 4025-4033 (2016) PUBMED 27609837 REFERENCE 2 (bases 1 to 772) AUTHORS Napoli JL. TITLE Physiological insights into all-trans-retinoic acid biosynthesis JOURNAL Biochim Biophys Acta 1821 (1), 152-167 (2012) PUBMED 21621639 REMARK Review article REFERENCE 3 (bases 1 to 772) AUTHORS Gonzales PA, Pisitkun T, Hoffert JD, Tchapyjnikov D, Star RA, Kleta R, Wang NS and Knepper MA. TITLE Large-scale proteomics and phosphoproteomics of urinary exosomes JOURNAL J Am Soc Nephrol 20 (2), 363-379 (2009) PUBMED 19056867 REFERENCE 4 (bases 1 to 772) AUTHORS Dieplinger B, Schiefermeier N, Juchum-Pasquazzo M, Gstir R, Huber LA, Klimaschewski L and Vietor I. TITLE The transcriptional corepressor TPA-inducible sequence 7 regulates adult axon growth through cellular retinoic acid binding protein II expression JOURNAL Eur J Neurosci 26 (12), 3358-3367 (2007) PUBMED 18052984 REFERENCE 5 (bases 1 to 772) AUTHORS Flajollet S, Lefebvre B, Rachez C and Lefebvre P. TITLE Distinct roles of the steroid receptor coactivator 1 and of MED1 in retinoid-induced transcription and cellular differentiation JOURNAL J Biol Chem 281 (29), 20338-20348 (2006) PUBMED 16723356 REFERENCE 6 (bases 1 to 772) AUTHORS Despouy G, Bastie JN, Deshaies S, Balitrand N, Mazharian A, Rochette-Egly C, Chomienne C and Delva L. TITLE Cyclin D3 is a cofactor of retinoic acid receptors, modulating their activity in the presence of cellular retinoic acid-binding protein II JOURNAL J Biol Chem 278 (8), 6355-6362 (2003) PUBMED 12482873 REFERENCE 7 (bases 1 to 772) AUTHORS Yamamoto M, Drager UC, Ong DE and McCaffery P. TITLE Retinoid-binding proteins in the cerebellum and choroid plexus and their relationship to regionalized retinoic acid synthesis and degradation JOURNAL Eur J Biochem 257 (2), 344-350 (1998) PUBMED 9826179 REFERENCE 8 (bases 1 to 772) AUTHORS Bucco RA, Melner MH, Gordon DS, Leers-Sucheta S and Ong DE. TITLE Inducible expression of cellular retinoic acid-binding protein II in rat ovary: gonadotropin regulation during luteal development JOURNAL Endocrinology 136 (6), 2730-2740 (1995) PUBMED 7750498 REFERENCE 9 (bases 1 to 772) AUTHORS Fawcett D, Pasceri P, Fraser R, Colbert M, Rossant J and Giguere V. TITLE Postaxial polydactyly in forelimbs of CRABP-II mutant mice JOURNAL Development 121 (3), 671-679 (1995) PUBMED 7720575 REFERENCE 10 (bases 1 to 772) AUTHORS Chapman JM and Curley RW Jr. TITLE Affinity purification of retinoic acid-binding proteins using immobilized 4-(2-hydroxyethoxy)retinoic acid JOURNAL Protein Expr Purif 1 (1), 63-69 (1990) PUBMED 1967079 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JACYVU010000069.1. On Nov 27, 2020 this sequence version replaced NM_017244.1. Sequence Note: This sequence has been modified as follows: removed 28 bp suspected to be vector contamination from the 3' end. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U23407.1, CO403862.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760384, SAMEA5760386 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-172 JACYVU010000069.1 39889424-39889595 173-354 JACYVU010000069.1 39892640-39892821 355-471 JACYVU010000069.1 39893011-39893127 472-772 JACYVU010000069.1 39893472-39893772 FEATURES Location/Qualifiers source 1..772 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="2" /map="2q34" gene 1..772 /gene="Crabp2" /note="cellular retinoic acid binding protein 2" /db_xref="GeneID:29563" /db_xref="RGD:62070" exon 1..172 /gene="Crabp2" /inference="alignment:Splign:2.1.0" misc_feature 76..78 /gene="Crabp2" /note="upstream in-frame stop codon" CDS 103..522 /gene="Crabp2" /note="cellular lipid-binding protein; cellular retinoic acid-binding protein II; CRABP-II; cellular retinoic acid-binding protein 2-like" /codon_start=1 /product="cellular retinoic acid-binding protein 2" /protein_id="NP_058940.1" /db_xref="GeneID:29563" /db_xref="RGD:62070" /translation="
MPNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDDTFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESENKMVCEQRLLKGEGPKTSWSRELTNDGELILTMTADDVVCTRVYVRE"
misc_feature 109..519 /gene="Crabp2" /note="lipocalin/cytosolic fatty acid-binding protein family; Region: lipocalin_FABP; cl10502" /db_xref="CDD:447910" misc_feature order(112..114,124..126,226..228,232..234,256..258, 262..264,268..270,289..291,295..297,301..303,391..393, 397..399,427..429,433..435,439..441,463..465,469..471, 475..477,496..498,502..504,508..510) /gene="Crabp2" /note="ligand binding cavity [chemical binding]; other site" /db_xref="CDD:381182" misc_feature 163..195 /gene="Crabp2" /note="propagated from UniProtKB/Swiss-Prot (P51673.2); Region: Nuclear localization signal. /evidence=ECO:0000250" exon 173..354 /gene="Crabp2" /inference="alignment:Splign:2.1.0" exon 355..471 /gene="Crabp2" /inference="alignment:Splign:2.1.0" exon 472..772 /gene="Crabp2" /inference="alignment:Splign:2.1.0" ORIGIN
gatctgttctgcaaaggggacagcaaggtacctttaggctaaaggactcggcgtccagtattctagttgaagatctaaagagaaagccaccttgctgccactatgcctaacttttctggcaactggaagatcatccgatcggaaaactttgaagaaatgctaaaagctctgggggtgaacatgatgatgaggaagattgctgtggctgcagcctccaagccagcagtggagatcaaacaggagaatgatgacactttctacatcaaaacctccaccactgttcgaaccacggagattaacttcaagatcggggaggaatttgaggagcagactgtggatgggagaccctgtaagagtttggtgaaatgggagagtgaaaacaaaatggtgtgcgaacagaggcttctgaagggggagggccccaaaacctcctggagccgagaactgaccaatgatggagagctaatcctgaccatgacagcagacgacgttgtatgcaccagggtctacgtccgagagtgagtgcctatgtccaagaacttcttctggaggccacaaacctccctcccatgtccattttacaaactagctctccccttactcctgagggtcactctctatgccagagaggggcagactaccaaagctcagaacccttccatttgcctggtcagaagtcccagctccataccaggatccttcctggaagagactgtctctctggcctctactctttatccttgtagtccaagtgatttagaatatttattgg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]